KEGG   Ceratosolen solmsi marchali: 105364708Help
Entry
105364708         CDS       T06056                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol00020  Citrate cycle (TCA cycle)
csol00640  Propanoate metabolism
csol01100  Metabolic pathways
csol01200  Carbon metabolism
Module
csol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:csol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105364708
   00640 Propanoate metabolism
    105364708
Enzymes [BR:csol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     105364708
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     105364708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 105364708
NCBI-ProteinID: XP_011501014
Position
Unknown
AA seq 331 aa AA seqDB search
MAVAAKVLSKFSIGARGGLLRSQIRFNYTETRKNLKIDSETKVICQGFTGKQGTFHCQQA
LDYGTKVVGGINPKKAGIEHLGKPVYKNVQEAKAATGATASVIYVPPPAAAAAIMEALDA
EMPLIVCITEGIPQHDMVKVKRRLLEQNKSRLIGPNCPGIIAPEQCKIGIMPGHIHLKGK
IGIVSRSGTLTYEAVNQTTLTGLGQTLCVGIGGDPFNGTDFIDCLEIFLQDPACQGIIMI
GEIGGSAEELAAEYLTEHNSGVKAKPVVSFIAGMTAPPGRRMGHAGAIISGGKGGAQDKI
NALERAGVIVTRSPAQMGNVLLKEMTRRGLA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgctaaggtattatcgaaattttcaattggagctcgtggtggattgttg
cgttctcaaattagatttaattatacagaaactagaaaaaatctaaaaattgattctgaa
accaaagttatttgtcaaggttttacaggtaaacaaggaacttttcattgtcaacaggcc
cttgactatggtacaaaagttgttggtggaataaatccaaaaaaagcaggaattgaacat
cttggtaagcctgtgtataaaaatgttcaagaggcaaaagctgcaactggtgctactgca
tctgtaatttatgtaccacctccagcagctgctgcagcaataatggaagctctagatgct
gaaatgcccttgattgtgtgtattacagaaggaattccacaacatgacatggttaaagta
aagagacgattattggaacaaaataaatctcgtctcattggtcctaattgtccgggaatc
attgcacctgaacaatgcaaaattggaattatgccagggcatatacatctaaaaggtaaa
attggtattgtttcacgatctggaacgttaacatatgaggctgttaatcaaactactctt
actggattaggtcaaacgttatgtgtcggtattggaggtgatccatttaatggtacagat
tttatcgactgtttagaaatatttttgcaagatccagcctgtcaaggcattattatgatt
ggtgaaataggtggtagtgctgaagaactggcagcagaatatcttactgagcataactct
ggagtgaaagctaaacctgttgtatcatttattgctggtatgacagctccaccaggtaga
agaatgggtcatgctggtgccatcatatctggaggaaagggtggagctcaagacaagatt
aatgcacttgaaagggctggcgttattgtaacaaggagtcctgctcaaatggggaatgta
ttattaaaagaaatgactcgtcgtggtcttgcttga

DBGET integrated database retrieval system