KEGG   Ceratosolen solmsi marchali: 105368237Help
Entry
105368237         CDS       T06056                                 

Definition
(RefSeq) nucleoside diphosphate kinase 7
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol00230  Purine metabolism
csol00240  Pyrimidine metabolism
csol00983  Drug metabolism - other enzymes
csol01100  Metabolic pathways
Module
csol_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
csol_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
csol_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:csol00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105368237
   00240 Pyrimidine metabolism
    105368237
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    105368237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csol04131]
    105368237
Enzymes [BR:csol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     105368237
Membrane trafficking [BR:csol04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    105368237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK DUF1126
Motif
Other DBs
NCBI-GeneID: 105368237
NCBI-ProteinID: XP_011505516
Position
Unknown
AA seq 360 aa AA seqDB search
MAADSERYIFEAEWYDKVSFTLKKFYLYFFPSDNSVELFDLKTRKTFLRRSKCNGVESKD
FYVGAMVTIFSRNIKITNFADQATKKKLSSKRVKTYVILKPNIINKLGEILKTISDYDFH
ISNLRMGQINLEDANEIFESTSDKLITLIECIIAGPVILLVLLSEDTTVRLQKLTTTFEE
NSISNGIYISDNKDEINFFSSEENIKQKIKSSAKLQNCTCCIIKPHAVQAKLFGPIIIDI
QKANFIISAVEQFYINSVNSEEFLEVYKGVLPDYAAMVSELQSGVCFAMEITHSDAQLDI
VSEFRKFCGPMDPEMARQLRPNTLRAKYGKTRIQNAVHCSDLSDDGLLEVEYFFQILNKN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggattcagaaagatacatttttgaagcagaatggtatgataaagtttctttt
acattgaagaaattttatttatatttttttccatcagataatagtgtagaactttttgat
ttaaaaactagaaaaacttttttacgaagatccaaatgcaatggagtggaatctaaagat
ttttacgttggggcaatggttactatattctctaggaacataaaaattacaaattttgct
gatcaagcaacaaaaaaaaaattatcatctaagagagtcaaaacatatgtaatattaaaa
ccaaatataatcaacaaattgggtgagattttaaaaactatttctgattatgattttcac
atatcaaatctcagaatgggtcaaattaatcttgaagatgcaaatgaaattttcgaatca
acaagcgataagttaataacattgattgaatgcataattgctggtccagttattctactt
gtattattaagcgaagatactacagttagattgcaaaaattaactactacatttgaagaa
aattccataagcaacggtatttatatctcagataataaagatgaaataaatttcttttca
tccgaagaaaatataaaacaaaaaataaaaagttcagctaaattacaaaattgcacatgc
tgtatcattaagcctcatgcagttcaagctaaattgtttggacccataattattgatata
caaaaagctaattttatcatatcagcagtagagcaattttatataaattctgtaaattca
gaagaatttttagaagtatataaaggcgttctgcctgattatgctgcaatggtcagtgaa
ctgcaatcaggagtttgttttgcaatggaaattacgcatagcgatgctcagttagatatt
gtatcagaattcagaaaattttgtggaccaatggatcctgaaatggctaggcagttacga
ccaaatacattacgtgctaaatatggaaagacaagaattcaaaatgctgttcattgttct
gatttatcggatgatggattattagaggtggagtacttttttcaaatcttgaacaaaaat

DBGET integrated database retrieval system