KEGG   Corynebacterium simulans: WM42_0375Help
Entry
WM42_0375         CDS       T04316                                 

Definition
(GenBank) methyltransferase domain protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
csp  Corynebacterium simulans
Brite
KEGG Orthology (KO) [BR:csp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:csp03009]
    WM42_0375
Enzymes [BR:csp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     WM42_0375
Ribosome biogenesis [BR:csp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    WM42_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AMO88128
UniProt: A0A127NRS7
Position
complement(387050..387916)
Genome map
AA seq 288 aa AA seqDB search
MLSHVIDVLADPNDGTALSGADDFARLVSESGHSFDVAKQGYVTLAPGAGLKHKGDSSEM
VSARETFLSLGHFAPFVEAVTGAVQDALDANELPETAEPMLLEVGAGTGYYLAHTLDSIA
EARGVGLDISPHAAKHLAKCHPRVGAVVADVWERLPLQDDSIDAVSVVFAPRNPAEFQRI
LRPGGEVIVLTPDLGHLDELREPLGILGVEEGKIERMYEQAAGYLEQAADPVDISYPMTL
DRASIAAQVGMSPSARHLEKEELAERMAKLPETMQVTAHARLDRLRAV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacacgtcatcgatgttctggccgacccaaacgatggcaccgcgctaagcggc
gccgacgattttgctcgtctcgtctctgagtctgggcactcttttgatgtggccaaacaa
ggctatgtcacccttgcccccggggcagggctaaagcataagggcgattccagtgagatg
gtttccgcgcgtgagaccttcttgtctttgggccacttcgccccatttgtggaggctgtc
actggcgcagtgcaggacgcacttgatgccaacgagttgcctgagactgccgagcctatg
ctgcttgaagtcggtgccggcaccggctattacctagcacataccttggattccatcgct
gaggcccgtggcgttggtttggatatttccccacatgctgccaagcatctggcaaagtgc
catccgcgcgttggcgccgtggtggcggatgtgtgggagcggttgccgctgcaggatgat
tccatcgatgcggtatcggtggtctttgccccgcgcaacccagcggagttccagcgcatc
ttgcgtccaggcggcgaggtcattgtcttgactccggacctcggccatctggatgaactg
cgcgagccgctgggaatcttgggcgtggaagaaggcaagatcgagcgcatgtacgagcag
gccgccggctacctggagcaggcagcagatccggttgatatctcttatccgatgaccctg
gatcgcgcctctattgccgcgcaggttggcatgagcccgtctgcccgccaccttgaaaag
gaagagcttgctgagcgcatggcaaaattaccagagaccatgcaggtcaccgctcatgcc
cgcctggaccgtctgcgcgcagtctaa

DBGET integrated database retrieval system