KEGG   Corynebacterium simulans: WM42_0769Help
Entry
WM42_0769         CDS       T04316                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csp  Corynebacterium simulans
Pathway
csp00071  Fatty acid degradation
csp00280  Valine, leucine and isoleucine degradation
csp00310  Lysine degradation
csp00362  Benzoate degradation
csp00380  Tryptophan metabolism
csp00620  Pyruvate metabolism
csp00630  Glyoxylate and dicarboxylate metabolism
csp00640  Propanoate metabolism
csp00650  Butanoate metabolism
csp00900  Terpenoid backbone biosynthesis
csp01100  Metabolic pathways
csp01110  Biosynthesis of secondary metabolites
csp01120  Microbial metabolism in diverse environments
csp01130  Biosynthesis of antibiotics
csp01200  Carbon metabolism
csp01212  Fatty acid metabolism
csp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WM42_0769
   00630 Glyoxylate and dicarboxylate metabolism
    WM42_0769
   00640 Propanoate metabolism
    WM42_0769
   00650 Butanoate metabolism
    WM42_0769
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WM42_0769
   00072 Synthesis and degradation of ketone bodies
    WM42_0769
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WM42_0769
   00310 Lysine degradation
    WM42_0769
   00380 Tryptophan metabolism
    WM42_0769
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WM42_0769
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WM42_0769
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WM42_0769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csp04147]
    WM42_0769
Enzymes [BR:csp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WM42_0769
Exosome [BR:csp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WM42_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AMO88511
UniProt: A0A127NTK6
Position
797939..799102
Genome map
AA seq 387 aa AA seqDB search
MTKNVYIASAARLPIGKFGGSLSRLSLTELGTLASREAIDRSGIPAADIDTTVASNVLPV
VPSDLYIGRKIALGIGMPDSSTALGVNRLCGSGVQAIISAAQLLQSGDGTTALVAGVESM
SQAPYSVDGMRSGKKMGDGKLYDWLTGALSCPFGTGHMGVTAENIARDYGISRERQDEFA
AESQRRAAAAQAENIQAEELVPVGDLDFDEHVRQTSVDKLARLKPAFAKDGTVTAGNASG
INDGAAAVVLTGQEELESRALTPLAKIVSWSIAGVDPTRMGLGPIAAAPKALNKAGLKLD
DIDLIESNEAFAAQAIAVQDELGFDPAKTNIYGGAVAHGHPVGATGVILVTRLAYALRRL
EKRYGLVTMCIGGGQGIALIIENEGAK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaatgtctacatcgccagcgcggcacgcttgcccatcggtaaattcggtggc
agtctctctcgtctatcactgacggaactcggcacgctcgcttctcgcgaagcgattgac
cgttcgggaattccggccgcagacatcgatacgacagtggcttccaacgtcctgccggta
gttccgagcgatctctacatcggccgcaaaatagccctcggcattgggatgccggactcc
tcaaccgcgctcggagtcaaccgtttgtgcggctcaggtgtccaggcaattatctccgcg
gcccagcttctgcaatctggtgacggcaccaccgccctagtcgccggcgtcgagtccatg
agccaggcgccctattccgtcgacggaatgcgcagcggcaagaagatgggtgacggcaaa
ctctacgactggctcaccggcgcgctgtcctgtcctttcgggacaggccacatgggtgta
acggcagaaaatattgcccgtgactacggtattagccgcgagcgccaggacgagttcgca
gcggaatcacagcgccgcgccgcggcggcgcaagcagaaaacatccaagccgaggaactg
gtccccgtaggcgacctggattttgatgaacacgtgaggcagacgagcgtcgacaagctg
gcgcgtctcaagccggcctttgccaaggatgggaccgtaaccgcaggcaatgcctccggc
attaacgacggcgcggccgcagtggtgctcacaggccaagaggagctggagtcgcgggcg
ctgacgccactggcgaagatcgtcagctggtccatcgccggcgtcgaccccacccgcatg
ggcctggggcccatcgccgcggcgccgaaggccctgaacaaagccggcctaaagctggac
gatatcgatctcatcgagtccaacgaagcctttgctgcccaggccatcgcggtgcaggac
gagcttggtttcgacccggctaagacgaacatctacggcggtgccgtcgcccacggccac
ccggttggcgccaccggcgtcatacttgtcacccgcttggcttatgcgctgcgccgccta
gaaaagcgatatggcctggtcaccatgtgtatcggcggcgggcaaggcatcgcgctgatc
atagagaacgaaggagcaaagtaa

DBGET integrated database retrieval system