KEGG   Corynebacterium simulans: WM42_0798Help
Entry
WM42_0798         CDS       T04316                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
csp  Corynebacterium simulans
Brite
KEGG Orthology (KO) [BR:csp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    WM42_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMO88540
UniProt: A0A127NSM1
Position
826910..828214
Genome map
AA seq 434 aa AA seqDB search
MTATLIILAIVIVTALAFDFTNGFHDTANAMATSIATGALKPFTAVAISALLNLIGAFLS
VHVAATVAKGIVNLDSYDLSVGTDGEALLMVVFTGLIGGIFWNLFTWLLGMPSSSSHALF
GGLIGAAFAALGSGGVAWSSIAGKIIIPAIASPFIAAMVSACGTALVYWVTNTIPERVKN
EHFRHGQIVTACLVSLAHGAGDAQKTMGVIFLALVAAGEANADQRIPTWVIVACAVAIAA
GTMSGGWRVIRTLGKGLVEIESPQGMAAEASSAAIILTSAAGGMALSTTHVSTGSILGTG
LGKKGAQVRWGVAMRMVSAWLITLPCAAAVGFATWWIARLVSGATNTLTGAIVDAIILLA
MVAAILLRARRNPVDASNVNDDWDADAESVDSSMQAHDKVAAGVATGNAPGAANGVHGVV
DDASSSAHEVSQGK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgacactaatcatcttggccatcgtgatcgtcactgcccttgcctttgacttc
accaacggcttccacgacaccgctaacgcaatggccacctccattgccaccggcgctcta
aagccatttaccgcagtcgccatttccgcattgctcaacctgatcggtgcctttctttcc
gttcatgttgccgcaaccgtggcaaaaggcatcgtcaaccttgattcctacgatctctct
gtcggaaccgatggagaagcactcctaatggtcgtattcaccggcctcattggcggcatc
ttctggaacctatttacatggctcctcggaatgccgtcctcttcttcccacgcccttttc
ggcggcctcatcggtgcagcctttgcagcccttggcagcggcggcgttgcctggtcttcc
atcgccggcaaaatcatcatcccagcaatcgcatcccctttcatcgccgccatggtttcg
gcctgcggcaccgcgctggtctactgggttactaacaccatcccagagcgcgtaaagaac
gagcacttccgccacggccagatcgtcaccgcatgcctagtttccctggcacacggcgca
ggcgacgcacagaagaccatgggcgtcatcttcctagccctcgtcgcagccggtgaggca
aatgccgatcagcgcatccccacctgggtcatcgttgcctgtgcagtggcaatcgcagcc
ggcaccatgtctggcggctggcgcgtcatccgcaccctgggcaagggcttggtggaaatc
gagtccccacagggtatggccgccgaggcatcttccgcagccatcatcctcacctccgcc
gctggcggcatggcactgtctaccacccacgtttccaccggctccatcctcggtaccggc
ctaggcaagaagggcgcacaggtccgctggggcgttgcaatgcgcatggtttccgcatgg
ctaatcaccctgccttgcgctgctgcagtcggcttcgccacctggtggattgcacgcctg
gttagcggtgcaaccaacaccctgactggcgccatcgttgacgccatcatcttgctcgcc
atggtcgcagcaatcctgctgcgcgctcgccgcaacccagtggatgcatccaacgtcaac
gacgactgggacgctgatgctgagtctgttgactcctccatgcaggctcacgacaaggtt
gccgccggcgttgccaccggcaacgctccgggcgccgcgaatggcgtacacggcgtcgtc
gacgacgcttccagctccgctcacgaagtctcccaaggaaagtag

DBGET integrated database retrieval system