KEGG   Corynebacterium simulans: WM42_0964Help
Entry
WM42_0964         CDS       T04316                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
csp  Corynebacterium simulans
Pathway
csp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:csp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    WM42_0964 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:csp03011]
    WM42_0964 (rplV)
Ribosome [BR:csp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    WM42_0964 (rplV)
  Bacteria
    WM42_0964 (rplV)
  Archaea
    WM42_0964 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMO88706
UniProt: A0A127P132
Position
complement(981226..981588)
Genome map
AA seq 120 aa AA seqDB search
MSETITSASATARYVRVTPMKARRVIDLVRGKSVAEALAILKYAPQGAAKPVAKVVASAA
ANAENNFGLDPRTLVVSEAYANEGPTMRRFQPRAQGRAFMIRKRTSHITVVVESQKEGAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccatcacctccgcatccgcaacggcccgctacgtccgcgttactccgatg
aaggcacgccgtgtcatcgatctggttcgcggcaagtccgtagccgaggcacttgcaatc
ctgaagtacgctccgcagggcgctgctaagccagtcgctaaggttgttgcttctgcagct
gctaacgctgagaacaacttcggtctggacccacgcaccctggtcgtctccgaggcatac
gccaacgagggcccgaccatgcgtcgtttccagccacgcgcacagggccgtgcattcatg
attcgtaagcgcaccagccacatcaccgtggtggtcgagagccagaaggaaggggccaag
taa

DBGET integrated database retrieval system