KEGG   Campylobacter sputorum: CSF_0576Help
Entry
CSF_0576          CDS       T04992                                 

Gene name
putA
Definition
(GenBank) proline dehydrogenase / 1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cspf  Campylobacter sputorum
Pathway
cspf00250  Alanine, aspartate and glutamate metabolism
cspf00330  Arginine and proline metabolism
cspf01100  Metabolic pathways
cspf01110  Biosynthesis of secondary metabolites
cspf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cspf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSF_0576 (putA)
   00330 Arginine and proline metabolism
    CSF_0576 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cspf03000]
    CSF_0576 (putA)
Enzymes [BR:cspf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CSF_0576 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     CSF_0576 (putA)
Transcription factors [BR:cspf03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    CSF_0576 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: ASM36480
Position
574532..577984
Genome map
AA seq 1150 aa AA seqDB search
MKQDVVLNSLKLAEELQNKVNSSISQKEKSFHEKMKKLLVNPKNKVMLIELLDRSFRSKD
SSKCFDLIKKTFDKYGVADFFSPYEKFLLFAFLNFGKLVPSISVPFFIDHIRQDTKDMVL
DANSSVLKPHIENRRRENITLNVNLIGEEVLGEGEAAFRIKKYEEAIKSDFISYISIKIT
TIFSQINIIDFDYSKKEIVKRLSHLYELAISEQKRQNMSKFINLDMEEYRDLELTSEAFK
EAISKYPDYQAGIVLQAYIPDSFKYLQDLFEFSKQRVENGGKPIKIRFVKGANMEAEETV
ASQKGWALPTFDKKVDTDSNYKKMLYFILENERYKYINIGIASHNIFEIAHAYTLISQSN
ALDSFTFEMLEGMSLQTSFELSKLHELILYAPVCDKEHFNNAIAYLVRRLDENTAKDNFM
RYFFDLKVGDENWEIQKEIFLNSLKGIEALDNTPRRKQNRLEPVIKSEISKTDIFVNESD
TDFVLQNNRKLANLIKEKYTILDAVEISAMGNKALHSDEILEVRNKINDKLIAKIGLASK
QGISEALDMAKNSKYSELSFEEIYQILSKAAEIFRAKRGELLGIAALEVGKTFGEIDPEI
SEAIDFIEFYPHSLRVLQKQNPKTKFKPKGISVTISPWNFPIGIPVGTIVGPLAAGNRVI
FKPSSLSSVTGYEICKMFWEAGIPKDALIYLPTKGKMVSECLLKDDLVKFCVLTGGEDTA
YNILKENPKIVLSAETGGKNATIVTKAADRDSAIKNIIHSAFSNSGQKCSATSLLILEDE
VYDDDNFKNTLVDAASSMATGDPFEFKNKIGTLADKPSDKVKKALSELKDYESWALKPEF
INNNEFIMKPCIKYGTKKGDFTHMSELFTPVLTVMRANDLKDAIDIANSTGYGLTGALES
LDEKEWEYYKENIEVGNIYINKPTTGAIVLRQPFGGVKKSAVGYGRKVGIYNYITQFLDI
SQDEVDVNLKENEFTTALASLNIDKDTLNAAKSYVYHYENEFSKEKEYISVRGEDNLFAY
KKIKSLLYIVDEKDSLKDILLVLIAAKVSGVKTAISYKDENEDIKFIKQYKDIFGIEFVK
EADFKDYERIRYHGDCNEIYKKASALAKIIIRNKPLLNGRFELLYYYNEKSTSVSFHRYG
NLGARALDFK
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagatgttgttttaaattctttaaaattagcagaagaacttcaaaataaagta
aatagcagcataagtcaaaaagagaaatcttttcatgaaaaaatgaaaaaactacttgta
aatcccaaaaataaagttatgctaattgaacttcttgatagaagttttagatcaaaagat
tcatcaaaatgttttgatttgataaagaaaacttttgataaatacggagttgctgacttt
tttagtccttatgagaaatttttattgtttgcttttttaaattttggaaagttagtgcct
agtataagtgtgccattttttatagatcatataaggcaagatacaaaagatatggtttta
gatgcaaatagtagcgttttaaaaccgcatatagaaaacagaagaagggaaaatatcact
ttaaatgtaaatcttatcggcgaagaagttttgggagaaggagaggctgcttttagaatt
aaaaagtatgaagaggcgataaaatctgattttataagttatatttctataaaaataaca
accatattttctcaaataaacattattgattttgattattctaaaaaagagatagtaaaa
agattatcgcatttatacgaattggctattagtgagcaaaagagacaaaatatgtctaaa
tttataaacttggatatggaggagtatagagatcttgagctaacttcagaggcttttaaa
gaggctatatcaaaatatccagattatcaagcgggtattgttttacaagcctacattcca
gatagttttaaatatctacaagatctttttgagttttcaaaacaaagagttgaaaatggc
ggtaagcctataaaaattcgctttgtaaaaggtgcaaatatggaagcagaagaaactgtt
gcgtctcaaaaaggctgggctcttcctacatttgataaaaaagtagatactgattcgaat
tacaaaaaaatgctttattttatactagaaaatgagcgttataaatatataaatatcggt
attgcaagccataatatatttgaaatagctcacgcttatactctcatatctcaatcaaat
gctcttgatagttttacttttgagatgttagagggtatgagtttgcaaacaagttttgag
cttagcaaacttcatgagcttatattatacgcaccggtttgtgataaagagcattttaat
aatgccatagcttatcttgtgagaagacttgatgaaaatacagccaaagataatttcatg
agatacttttttgatcttaaagttggcgatgaaaactgggaaattcaaaaagagatattt
ttaaattctcttaaaggtattgaagcattagataatacccctagaagaaaacaaaataga
ttagagcctgtgataaaaagtgaaatatctaaaactgatatttttgttaatgaatcagat
actgattttgttttgcaaaataatagaaaattagcaaatttgataaaagaaaaatataca
attttagacgcagtagagatatctgctatgggaaataaagctttgcatagtgatgagatt
ttggaagtaagaaataaaattaacgataaactcatagcaaagataggtttagccagtaag
caaggtatatctgaggctttagatatggctaaaaactctaaatatagtgagcttagtttt
gaggaaatatatcaaattttaagcaaagcagctgaaatttttagagcaaaaagaggcgag
cttttaggtatagcagctcttgaagttggaaaaacttttggagaaattgaccctgagata
agcgaagcgatagattttatagaattttatccacactctcttagagttcttcaaaagcaa
aatccaaaaactaaatttaaaccaaaaggcattagtgtaacgatatctccttggaatttt
cctataggaattcctgttggaacgatagttggaccacttgctgctggaaatagagtgata
tttaagccatcttcattaagtagcgtaaccggatatgaaatttgtaagatgttttgggaa
gccggcattccaaaagacgcacttatatacttaccaacaaaaggcaaaatggtaagtgag
tgtttgttaaaagatgatttggttaaattttgtgtattaactggtggcgaagatacagct
tataatatcttaaaagaaaatcctaaaattgttttgagtgctgaaactggcggtaaaaat
gcaactatcgtaacaaaagcagcagatagagatagtgctataaaaaatataatccactca
gctttttcaaactctggacaaaaatgctcagctacatcacttcttatacttgaagatgag
gtttatgatgatgataattttaaaaatactttggttgatgcagcttcttcaatggctact
ggagatccatttgagtttaaaaataaaattggcacactggcagataagccgagcgataaa
gttaaaaaagctttaagcgaattaaaagattatgaatcatgggcgttaaagcctgagttt
ataaacaataatgagtttataatgaagccttgcataaaatatggcacaaaaaaaggagat
tttactcatatgagtgagcttttcacacctgttttaaccgttatgagggcaaatgattta
aaagatgccatagatatagcaaactcaactggctatggtttaacaggagcgttagaaagt
cttgatgaaaaagagtgggagtattataaagaaaatattgaagttggaaatatctatata
aataagccaacaacaggagcgatagttcttcgccaaccttttggcggtgttaaaaaatct
gccgtaggatatggtaggaaggttggaatttataactatataactcagtttttggatata
tcgcaagatgaagtagatgtaaatttaaaagaaaatgaatttacaactgctcttgcatct
ttaaatatagataaagatacattaaatgccgcaaaaagctatgtttatcactatgaaaat
gagtttagtaaagaaaaagagtatatttctgtaaggggagaggataatttatttgcttat
aaaaagataaaatcgcttttatatatagttgatgaaaaagatagcttaaaagatatactt
cttgttttaattgctgccaaggtttctggcgtaaaaacagctataagctataaagatgaa
aatgaagatatcaaatttataaaacaatataaagatatttttggaatagagtttgtcaaa
gaggctgattttaaagattatgaacgaattagatatcatggagattgtaatgaaatttat
aaaaaagcaagtgctttggcaaagattattataagaaataaacctcttttaaatggtcgc
tttgagttgctgtattattataatgaaaaatcaacaagcgtgtcgtttcatagatatgga
aatttaggtgctagagcactagatttcaaatga

DBGET integrated database retrieval system