KEGG   Corynebacterium sphenisci: CSPHI_08530Help
Entry
CSPHI_08530       CDS       T05122                                 

Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
csph  Corynebacterium sphenisci
Pathway
csph03030  DNA replication
Brite
KEGG Orthology (KO) [BR:csph00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CSPHI_08530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csph03032]
    CSPHI_08530
Enzymes [BR:csph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     CSPHI_08530
DNA replication proteins [BR:csph03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CSPHI_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 DnaG_DnaB_bind DnaB_bind Toprim_4 Toprim_2 Toprim Toprim_3
Motif
Other DBs
NCBI-ProteinID: APT91061
UniProt: A0A1L7CZ92
Position
complement(1837848..1839782)
Genome map
AA seq 644 aa AA seqDB search
MAMARGRIPDSDIAAIRENTPLEEVVGEYVQLKPGGADSLKGLSPFKDERTPSFHVRPNH
GYYHCFSTGKGGDVFSFLMEMEHLSFPEAVEACAERIGYRINYEGGGTGRREEPGTRQRL
VAANREAQKFYAERLGTPEAAVARDFLADRGFTAEHARAFGCGYAPAGWDTLTRHLQRLG
FEFAELEKAGLAKMGRKGPIDRFHRRLLWPIRNMAGDVIGFGARKLFDDDQLGKYMNTPE
TMLYKKSKVLFGLDLAKRAIAESHRAVIVEGYTDVMAMHAAGETTAVAACGTAFGEEHLQ
LLRRLMLDDSFFRGELIYTFDGDEAGQKAALRAFAGEQQFTGQSYVAVAPAGADPCDLRL
AKGDAALRDLVATRTPMVEFVLRTLLADFDLDTANGRVAALNRVVPVLAQVRESALRDEY
AREVAGWIGWNDEAELVRRVREEARAPRKADPGERRRRRLAEAAAAEERRRVAAGPPTTP
RPDPRDPRLHVQREALKLAVQEPAALGPVFSELDPEVFTHPAYRAVFDAVAAAGGIPADG
GGAGWVADLAAAAADEVVRGLVTELGVEEIHVDPPALAGYAASVLARLQEVWVGQQIAQV
KGTLQRMRPGDDEAGYRRLFEDLIGLEEYRRELLAEALRGPAAE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtggccatggccagaggacgcatcccggacagcgatatcgcggcgatccgcgagaacacc
ccgctggaggaggtcgtcggcgagtacgtgcagctcaaaccgggtggggcggattcgctc
aagggcctgagccccttcaaggacgagcgcacccccagcttccacgtccggcccaaccac
ggctactaccactgcttctccacgggcaagggcggggacgtgttcagcttcctcatggag
atggagcacctgagcttcccggaggcggtggaggcctgcgcggagcggatcggctaccgg
atcaactacgagggcggcggcaccggccgccgcgaggagccgggcacccggcagcggctg
gtcgcggcgaaccgggaggcgcagaagttctacgccgagcggctggggaccccggaggcg
gcggtggcccgggacttcctcgccgaccggggcttcaccgccgagcacgcccgcgccttc
ggctgcggctacgcccccgccggctgggacaccctgacccggcatctgcagcggctgggc
ttcgagttcgcggagctggagaaggcgggcctggcgaagatgggtcgcaagggccccatc
gaccgcttccaccggcggctgctgtggccgatccggaacatggccggcgacgtgatcggc
ttcggggcgcgcaagctcttcgacgacgatcagctgggcaagtacatgaacaccccggag
acgatgctgtacaagaagtcgaaggtgctcttcggcctggatctggccaagcgcgccatc
gcggaatcgcaccgggcggtgatcgtggagggctacaccgacgtgatggcgatgcacgcc
gcgggggagaccaccgcggtggccgcctgcggcaccgccttcggcgaggagcatctgcag
ctgctgcgccggctgatgctcgacgacagcttcttccgcggggagctcatctacaccttc
gacggcgacgaggccgggcagaaggcggcgctgcgcgccttcgccggggagcagcagttc
accgggcagtcctacgtggcggtggcccccgccggggcggacccctgcgatctgcggctg
gccaagggcgatgcggcgctgcgggacctggtcgccacgcgcaccccgatggtggagttc
gtgctgcgcaccctgctcgcggatttcgacctggacaccgccaacggccgggtcgcggcg
ctgaaccgggtggtcccggtgctggcccaggtgcgcgaatcggcgctgcgcgacgagtac
gcccgggaggtcgccggctggatcggctggaatgacgaggcggagctggtgcgccgggtg
cgcgaggaggcccgggcgccgcggaaggccgatcccggcgagcggcgccggcgccggctg
gcggaggccgccgccgcggaggagcgccgccgcgtcgcggcgggcccgccgacgacaccg
cggccggatccgcgggatccgcggctgcatgtgcagcgggaggcgctgaagctggcggtg
caggagccggcggcgctgggcccggtgttctccgagctggacccggaggtgttcacgcac
ccggcctaccgggcggtgttcgacgcggtggccgccgccggcgggatccccgccgacggc
ggcggcgccgggtgggtcgccgatctcgccgctgcggccgccgatgaggtggtgcgcggg
ctggtcaccgagctgggcgtggaggagatccacgtcgatccgccggccctggccggctac
gccgcctcggtgctcgcccggctgcaggaggtgtgggtgggccagcagatcgcccaggtc
aaggggaccctgcagcggatgcggcccggtgatgacgaggccggctaccggcgcctgttc
gaggatctgatcggcctggaggagtaccgccgggagctgctcgccgaggcgctgcgcggc
ccggccgcggaatag

DBGET integrated database retrieval system