KEGG   Corynebacterium sphenisci: CSPHI_09395Help
Entry
CSPHI_09395       CDS       T05122                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csph  Corynebacterium sphenisci
Pathway
csph00450  Selenocompound metabolism
csph00970  Aminoacyl-tRNA biosynthesis
csph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CSPHI_09395
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSPHI_09395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csph01007]
    CSPHI_09395
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csph03016]
    CSPHI_09395
Enzymes [BR:csph01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CSPHI_09395
Amino acid related enzymes [BR:csph01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CSPHI_09395
Transfer RNA biogenesis [BR:csph03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CSPHI_09395
 Prokaryotic type
   Other AARSs
    CSPHI_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APT91191
UniProt: A0A1L7CZL9
Position
complement(2026381..2028210)
Genome map
AA seq 609 aa AA seqDB search
MSRILVAVAWPYANGPRHIGHVAGFGVPSDVFARYQRMIGNEVLMISGTDEHGTPLLVQA
EKEGVAVQELADRYNRQIVEDLAGLGLSYDLFTRTTTRNHYAVVQELFRGLHDNGYLVRE
TMMGAISPSTGRTLPDRYIEGTCPICGAGGARGDQCDNCGNQLDPADLIDPVSKINGETP
EFVETEHFLLDLPALAEKLAEWLRGRDDWRPNVLKFSLNLLEDIRPRAMSRDIDWGVPIP
LEGWSEEASKKLYVWFDAVVGYLSASIEWAHRIGDPEAWRRWWNDPEARSFYFMGKDNIT
FHSQIWPAELLGYRGEGARGGEVGELGELRLPTEVVSSEYLTMSGSKFSSSKGVVIYVKD
FLAEFGADPLRYFIAVAGPENQDTDFTWDEFVRRVNNELANGWGNLVNRTVSMAHKNFGE
VPEPGELTAADRELLELAERTFGSAGEAIGASRFRTGTTAIMHVVGEANAYIAAQEPWKL
AKDPEARGRLATVLWTALQVVADCNVMLTPFLPASAQKVHETLGGEGLWAAMPRVDEVVD
DMPVQPVGVGLPEPGRGYPVIRGDYAAGAARWGRRDMVPGTPLAKPKPLFAKLDPELGET
GPEWAPVVR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcatcctcgtcgccgtcgcctggccctacgccaacggtccccgccatatcgga
cacgtcgccgggttcggggtcccctcggacgtcttcgcccgctaccagcggatgatcggc
aacgaggtgctgatgatctccggcaccgacgagcacggcaccccgctgctggtgcaggcg
gagaaggagggcgtcgccgtccaggagctcgccgaccggtacaaccggcagatcgtcgag
gacctcgccgggctgggcctgtcctatgacctgttcacccgcaccaccacccgcaaccac
tacgcggtggtgcaggagctcttccggggcctgcacgacaacggctacctggtgcgggag
accatgatgggcgcgatcagcccctcgaccggccgcaccctgccggaccgctacatcgag
ggcacctgccccatctgcggcgccggcggcgcccgcggcgaccagtgcgacaactgcggc
aaccagctcgacccggccgatctcatcgacccggtgtccaagatcaacggcgagaccccc
gagttcgtggagaccgagcatttcctgctcgacctgcccgccctggccgagaagctcgcc
gagtggctgcgtggccgcgacgactggcggccgaacgtgctgaagttctccctcaacctg
ctcgaggacatccggccccgggcgatgagccgggacatcgactggggggtgccgatcccc
ctggagggctggagcgaggaggcctcgaagaagctctacgtgtggttcgacgccgtggtc
ggctacctttcggcctccatcgaatgggcgcaccggatcggcgacccggaggcctggcgg
cgctggtggaacgacccggaggcgcggtccttctacttcatgggcaaggacaacatcacc
ttccactcccagatctggccggcggagctgctcggctaccggggcgagggcgcccgcggc
ggcgaggtcggcgagctcggcgaactgcggctgcccaccgaggtggtctccagcgagtac
ctcaccatgagcgggtcgaagttctcctcctccaagggcgtggtcatctacgtcaaggac
ttcctcgccgagttcggcgccgacccgctgcgctacttcatcgcggtggccggtccggag
aaccaggacaccgacttcacctgggacgagttcgtccgccgggtgaacaacgagctggcc
aacggctggggcaacctggtcaaccgcaccgtgtccatggcgcacaagaacttcggcgag
gtgcccgaacccggggagctcaccgcggcggaccgggagctgctggagctcgccgagcgc
accttcggcagcgccggggaggccatcggcgcctcccgcttccgcaccgggaccaccgcg
atcatgcacgtggtgggggaggccaacgcctacatcgccgcccaggagccgtggaagctg
gcgaaggaccccgaggcccgggggcgcctggccaccgtgctgtggaccgccctgcaggtc
gtcgcggactgcaacgtgatgctcacccccttcctgccggcctcggcgcagaaggtgcac
gagaccctcggcggggagggcctgtgggcggcgatgccccgggtcgacgaggtcgtcgac
gatatgccggtgcagccggtgggcgtgggcctgccggagcccggccgcggctacccggtg
atccgcggcgactacgccgccggcgccgcccgctggggccgccgcgacatggtcccgggc
acgcccctggccaagccgaagccgctgttcgcgaagctcgacccggagctcggcgagacc
ggtccggagtgggcgccggtggtgcgctga

DBGET integrated database retrieval system