KEGG   Capnocytophaga sputigena: CGC55_02045Help
Entry
CGC55_02045       CDS       T05393                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cspu  Capnocytophaga sputigena
Pathway
cspu00860  Porphyrin and chlorophyll metabolism
cspu01100  Metabolic pathways
cspu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cspu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CGC55_02045 (hemN)
Enzymes [BR:cspu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CGC55_02045 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Fer4_14 DUF2517
Motif
Other DBs
NCBI-ProteinID: ATA83358
UniProt: A0A250FH01
Position
complement(429128..430492)
Genome map
AA seq 454 aa AA seqDB search
MPISLIQKYNVAGPRYTSYPTVPYWDSSTFSTEKWLESLSKSYSESNSTEGISLYIHLPF
CESLCTFCGCHKRITKRHEMEIPYIEAVLKEWQLYTDFLKERPRIKEIHLGGGTPTFFQP
SQLRRLIEGIFERADRVENYEFSFEGHPNNTTEAHLQTLYNLGFKRVSYGVQDYSPKVQK
AIHRLQPFENVQRVTEQARTIGYTSVSHDLVFGLPFQTLDDVLFTIDKSNTLRPDRIAFY
SYAHVPWIKGSGQRGFKDEDLPTGEVKRQLYEVGKQHLLEAGYIEIGMDHFALPADSMYY
AFKNKQLHRNFMGYTASKTQVMIGLGMSSISDSWYGFAQNEKDLDDYYARLEKNEIPVCK
GHILNKEDLIIRRHILNLMCQFETSWSDEALQFPEINEVIMHLQEMQNDGLLHIANNHIE
VPDAGKPFIRNICMAFDLHLQRKMPNTKIFSMTV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccaatatctctcattcaaaaatacaatgtagcaggtcctcgctatactagctaccct
actgttccttattgggatagtagtactttttccactgaaaaatggttagagagtttatcc
aaatcatattctgagagtaatagtactgaaggtattagtctttacattcatttacctttt
tgtgagagcctttgtactttttgtggttgtcataagcgtattaccaaacgtcacgaaatg
gaaataccttatatagaagcagtactcaaagagtggcaattgtatactgattttttgaaa
gaacgccctcgtattaaagaaatacatttaggaggtggtactcctaccttttttcaacct
tctcaattacgccgattgatagaaggcatttttgagcgagctgatagagtagaaaactat
gagtttagctttgaagggcatcctaataacaccactgaagctcatttacaaacactttac
aatttaggtttcaaacgtgtgagttatggtgtgcaagattattcacctaaagtgcaaaaa
gccattcatcgtttgcaaccttttgagaatgtacagcgtgttaccgaacaagccagaact
atcggctatacctcagtgagccatgatttggtctttggattgccatttcaaaccttagat
gatgtactctttactattgataaaagtaatacccttcgtccagatcgtatagctttctat
agttatgcacatgtgccttggataaaaggtagtggacaacgcggttttaaagatgaagat
ctacctacaggagaagtgaagcgtcaattgtatgaagtaggtaaacaacatctacttgag
gcaggctatatagaaatagggatggatcactttgctttacctgctgatagtatgtactac
gcatttaaaaataaacagttgcatcgtaactttatggggtatacagcctctaaaacccaa
gtgatgataggtttaggaatgtcgtctatcagtgatagttggtatggttttgcacagaat
gaaaaagatttagacgactattatgcacgtcttgaaaagaatgaaatccctgtttgtaaa
ggacatatccttaataaagaagatttgattataaggcgtcatattcttaatctaatgtgt
cagtttgagacctcttggagtgatgaggcacttcaatttcctgaaataaatgaagtaata
atgcacttgcaggaaatgcaaaatgatggattgttgcatatagcaaataatcatatagaa
gttcctgatgcaggtaaaccttttattagaaatatatgtatggcttttgatttacattta
caacgcaaaatgcctaacaccaaaatatttagtatgacagtttaa

DBGET integrated database retrieval system