KEGG   Capnocytophaga sputigena: CGC55_03510Help
Entry
CGC55_03510       CDS       T05393                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cspu  Capnocytophaga sputigena
Pathway
cspu00010  Glycolysis / Gluconeogenesis
cspu00020  Citrate cycle (TCA cycle)
cspu00620  Pyruvate metabolism
cspu01100  Metabolic pathways
cspu01110  Biosynthesis of secondary metabolites
cspu01120  Microbial metabolism in diverse environments
cspu01130  Biosynthesis of antibiotics
cspu01200  Carbon metabolism
Module
cspu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cspu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGC55_03510 (pckA)
   00020 Citrate cycle (TCA cycle)
    CGC55_03510 (pckA)
   00620 Pyruvate metabolism
    CGC55_03510 (pckA)
Enzymes [BR:cspu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CGC55_03510 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ATA83636
UniProt: A0A2A3N2U0
Position
complement(713887..715470)
Genome map
AA seq 527 aa AA seqDB search
MSKPKTLSVDKYGIKNANVRYQLSADELHQETLDKKLGVEASSGAIAINTGEFTGRSPKD
RFIVKDDITKDRVWWGNINIPFEPEKFDKLYEKVVAYLSSKEIYVHDGYVCADPKYRTNI
RTITELPWSNLFAFNMFLRVEDSELASFNEDWLVVNAPGFKADPAVDGTRQANFAILNFT
KKIALIGGTGYTGEIKKGIFSAMNFELPVFRNTMPMHCSANVGKDGDTAIFFGLSGTGKT
TLSADPNRHLIGDDEHGWTPENTVFNFEGGCYAKVVDLTAEKEPEIFAAIKKGAILENVI
MDDKGVVDFARTDITENTRVSYPIYHIANIQPGSIGHNPKNIFFLTFDAYGVLPPISKLT
PEQAAYQFVSGYTSKVAGTEVGITTPQKTFSACFGAAFMPLHPAEYGKRLAEKIKETGVN
VWLVNTGYNGKMKRCSLKDTRALITAALTGKLNNVEYKELPIFGFKVPQSCEGVSDQSIL
NSENTWDDKAQFSAKLKELAESFVQNFKDKKFAEGASADVLAGAPKL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaaaaacactttccgttgataaatacggaattaaaaacgctaatgttcgt
taccaattgtctgctgacgaacttcaccaagaaactttggacaaaaaattaggtgttgaa
gcatcttctggagctatcgctatcaacacaggtgagtttactggtcgttctcctaaagac
cgcttcatcgtaaaagatgatatcaccaaagatcgcgtatggtggggtaacatcaacatc
cctttcgaacctgaaaaattcgataaactatacgaaaaagtagtagcttatctttcaagt
aaagaaatttacgttcacgatggctatgtttgcgccgaccctaaataccgcaccaatatc
cgtactattactgaacttccttggagcaaccttttcgcttttaatatgttcttacgtgta
gaagatagcgaactcgcttctttcaatgaagattggttagttgttaatgctcctggtttc
aaagctgacccagctgtagatggcactcgtcaagctaacttcgcaatccttaactttact
aaaaaaatcgcccttatcggtggtactggttataccggcgaaattaaaaaaggtatcttc
tctgctatgaactttgaattgcctgtgttccgcaacactatgccaatgcactgttctgct
aacgttggtaaagacggcgatactgctatcttctttggtctttctggtactggtaaaact
accctttctgctgaccctaaccgccaccttatcggtgatgacgaacacggttggactcct
gaaaataccgtattcaacttcgaaggtggttgctacgctaaagtagtagaccttaccgct
gaaaaagaacctgaaatcttcgccgctatcaaaaaaggtgctatcctcgagaacgtaatt
atggatgataaaggtgttgttgattttgctcgcactgatatcactgaaaacactcgtgtt
tcttatcctatctatcacatcgctaatatccaaccaggttcaataggtcataaccctaaa
aacatcttcttccttacttttgatgcttatggtgtattgcctccaatctctaaattgact
cctgaacaagctgcttaccaattcgtttctggttatacttctaaagttgctggtactgag
gtaggtatcactactcctcaaaaaactttctctgcttgcttcggagcagcctttatgcct
cttcacccagctgaatatggaaaacgtttggctgaaaaaatcaaagaaactggcgtaaac
gtatggttggtaaacaccggttacaatggtaaaatgaaaagatgcagcttgaaagatacc
cgcgctcttatcactgcggctcttactggcaaacttaacaacgttgagtacaaagaatta
cctatcttcggtttcaaagtacctcaatcttgcgaaggtgtttcagatcaaagcatcttg
aactcagaaaacacttgggacgacaaagctcaattcagcgctaaactcaaagaattggct
gaatcatttgtacaaaacttcaaagataaaaaattcgctgaaggtgcaagtgctgacgtc
ctcgctggtgctcctaaattgtaa

DBGET integrated database retrieval system