KEGG   Capnocytophaga sputigena: CGC55_09370Help
Entry
CGC55_09370       CDS       T05393                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
cspu  Capnocytophaga sputigena
Pathway
cspu00633  Nitrotoluene degradation
cspu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cspu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CGC55_09370
Enzymes [BR:cspu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     CGC55_09370
  1.-  
   1.-.-  
    1.-.-.-  
     CGC55_09370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase UPF0175 HTH_24 HTH_5
Motif
Other DBs
NCBI-ProteinID: ATA84702
UniProt: A0A250FHV8
Position
complement(2013024..2013617)
Genome map
AA seq 197 aa AA seqDB search
MNFLEIAQKRYAAKAYRNEKISEAKIKELAEILRLSPSSVNSQPWKFAIIGDEALKADLA
AHSFFNEQKIKEASHLIVFFAYDDTAAFENHFKANQPQPVVDYYESVKAGDDEKAKAWFQ
KQVYLATGFFVAACGAEGIDATPMEGIDTAYYTEKLQVKGCKAVLAVAVGYHSEADGNHP
SKTPKKRLPLEEVVEIR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttagaaatcgcacaaaagagatatgctgccaaagcatatcgcaatgagaag
ataagtgaagctaaaatcaaagaattggcagaaattctccgcttatctccttcttcagta
aatagtcagccttggaaatttgctatcataggtgatgaagccctcaaagccgacttggca
gcgcattcattcttcaacgaacagaagataaaagaggctagtcacctcatcgtgtttttc
gcttatgatgatacagccgcttttgaaaaccatttcaaagccaatcagccacaacctgta
gtagattattacgaaagtgtaaaagctggtgatgatgaaaaagcgaaggcgtggtttcaa
aaacaagtgtatttggcaacaggtttctttgtagccgcttgtggagcagagggtatcgat
gccacccctatggaaggaattgatacggcttattacactgaaaaattgcaagtaaaaggc
tgtaaagcggtacttgctgtagcagtaggctatcacagtgaagccgatggcaaccaccca
agtaagactcctaagaagagacttccactggaagaagtagtggaaattcgttaa

DBGET integrated database retrieval system