KEGG   Capnocytophaga sputigena: CGC55_10055Help
Entry
CGC55_10055       CDS       T05393                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cspu  Capnocytophaga sputigena
Pathway
cspu00670  One carbon pool by folate
cspu01100  Metabolic pathways
cspu01120  Microbial metabolism in diverse environments
cspu01200  Carbon metabolism
Module
cspu_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cspu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CGC55_10055
Enzymes [BR:cspu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CGC55_10055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ATA84827
UniProt: A0A250FLH5
Position
2128159..2129826
Genome map
AA seq 555 aa AA seqDB search
MTDLEIAQKAQMLPIREVAKKLNISEDDLDPYGKYKAKLPLHFINAEKMKHSKLVLVTAI
TPTPAGEGKTTVSIGLTEGLNKIGKKAIAVLREPSLGPVFGIKGGAAGGGYSQVVPMEDI
NLHFTGDFSAIEKANNLLAAVIDNNIQSKTHSIGIDPRTVVWKRVMDMNDRALRHIVVGL
GGHTHGVPREDGFNITPASEIMAILCLSESFSDLKRRIGNIYVGKKFDGTPVFARDLNVV
GAMALLLKEAIKPNLVQTLENNPAILHGGPFASIAQGTNTVLATKMGLSLGDYVVTEAGF
GADLGAEKFLNIKCTSAGLAPDAVVIVATIRALRHHGGAKKEEYNTPCLEKVKIGIANLE
KHIENVQLFGLKAVVAINYFPNDSEEEIAYIKEVCAQKGVQAIVSKGFSEGGKGTEELAH
AVVAIAESGESHFKPLYNNEASIEEKITTVATKIYGASKVNYSGKAVNQLKQINKLGFDK
MPICMVKTPKSLSDDEKKLARPTDFEVTVREFEFASGAGFVIPILGDTVRMPGLPSVPAA
EGMDIDDEGVITGLS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttagaaatcgcccaaaaggcacagatgctccccatcagagaggtagctaaa
aaattgaacatcagcgaggacgacctcgacccttatggaaaatacaaggctaaactgccg
ttgcactttatcaatgccgagaagatgaaacacagtaagttagtgctggttacggctatt
acgcctacgcctgcaggtgagggcaaaactacggtgagcataggtcttacggaaggactc
aacaaaataggcaaaaaagcgattgcggtattgcgtgaaccgtcgttaggacctgttttt
ggtatcaaaggaggggctgctggtggtggctattcgcaagtggtgcctatggaggatatc
aacttgcactttacgggcgacttttcggctattgagaaggctaacaacctcttggcagcg
gttatcgataataatatccagagcaaaacccactctataggcatcgacccgcgcacagtg
gtgtggaaacgcgtgatggatatgaacgaccgcgcactgcgccatatagtagtaggttta
ggtggacatacacacggcgtgcctcgcgaagatggttttaatatcacaccagcttccgag
attatggcaatattgtgcttgtcagaaagtttttccgacctaaaaagacgcatcggcaac
atctatgtaggcaaaaagtttgatggtactcccgtatttgcacgcgatttgaacgtagta
ggggcaatggcactactgctcaaagaagctatcaaacctaacctcgtgcaaacccttgaa
aacaatccagctatcttgcacggtggtccctttgccagcattgcccaaggtacaaatact
gttttggctaccaaaatgggactctcattaggcgactatgtagttaccgaagcaggtttt
ggcgccgaccttggggctgaaaaattcctcaatatcaaatgtacttcagcaggcttagcc
cccgatgcagtggtgattgtagcgactatccgcgccttgcgccatcacggaggggctaaa
aaagaagagtataacaccccttgcttggaaaaagtgaaaatcggtattgccaatttggaa
aaacatattgagaatgtacaactcttcggactcaaagcagtggtagcaatcaactatttc
cctaacgatagcgaggaagaaatcgcttatataaaagaagtatgcgctcaaaaaggagtg
caagcgattgtgagcaaagggtttagtgaaggaggtaaaggaactgaagaactcgcccac
gcggtagttgctatagctgagagtggtgagagccattttaaacctttgtacaacaatgag
gcgagtatagaagaaaaaatcactacagtagctactaaaatctatggagcgagcaaggtg
aactacagtggcaaagcagtgaaccagttaaagcaaatcaataaattaggctttgataaa
atgcctatttgtatggtgaaaacccctaaatcgctcagcgatgacgagaaaaaactcgcc
cgtcctaccgattttgaggtaactgtgcgcgagtttgaatttgcctctggggcgggcttt
gtaatcccaatattaggcgatacggtgcgtatgccaggactccccagtgtgcctgctgcc
gaaggtatggatatagatgatgaaggcgttatcacaggactctcgtaa

DBGET integrated database retrieval system