KEGG   Capnocytophaga sputigena: CGC55_12330Help
Entry
CGC55_12330       CDS       T05393                                 

Gene name
trpD
Definition
(GenBank) bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
cspu  Capnocytophaga sputigena
Pathway
cspu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cspu01100  Metabolic pathways
cspu01110  Biosynthesis of secondary metabolites
cspu01130  Biosynthesis of antibiotics
cspu01230  Biosynthesis of amino acids
Module
cspu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cspu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGC55_12330 (trpD)
Enzymes [BR:cspu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     CGC55_12330 (trpD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CGC55_12330 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Peptidase_C26 PBSX_XtrA
Motif
Other DBs
NCBI-ProteinID: ATA85235
UniProt: A0A250FLJ5
Position
complement(2659360..2660988)
Genome map
AA seq 542 aa AA seqDB search
MILLIDNYDSFVFNVAQYLGELTDEEVRTVRNDQLTLAEIRSLKPSRIVLSPGPKHPKDS
GICLEILKEITDIPILGICLGHQAFGLVHGGTVKRLEVPLHGKTSVLTVTKPQSILFKGL
PQQFSVMRYHSLYVDKDTLPQELIITALSDDEVIMALQHKTKPIHSIQFHPESFFTEYGK
NILKNFLIGTQAVQSVQNTQEKAKAYANEVFKTALKKLQENQPLGDSDFKQICGVLHSKQ
YDIVQLGALFVLISEKSLYPESLTAFVRNILAYSTTFADPRPMIDLCGTGGDGLKTINIS
TTVAFIVAALGVKVAKHGNRSVTSQSGSTDVLGELGIAMESNLMKQLDSLEKNGLAFFHA
PFFHNLVGEVREVRQRLGIRTVFNVLGPLLHPNTKLKYQLVGLYHEPVMRLYAETLQLLG
REHALVVRGNDGLDEISICDETKIVEVKGKQILEYTIAPEMFGFKRAFHTDIQGGTPTEN
AEILRRTLKGEERGAKADIVILNAMFALYTANVVKQPAEAKPLIEEALRSGKVWQLVSKL
VN
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgattttactaatagataattacgattcatttgtttttaatgtagcacaatacctcggt
gaactcactgatgaagaagtgcgtactgtgcgcaatgaccagctcactcttgccgagata
cgcagtctaaaaccctcacgtatagtgctttcaccaggacctaaacaccctaaggacagt
gggatttgtttggaaatactaaaagaaattaccgatattcctattttaggtatctgttta
gggcatcaggcgtttggactggtgcacggcggcactgtaaaacgattagaagtacctttg
cacggcaagacttctgtacttaccgttaccaaaccacaatcgatattgtttaaaggtttg
ccacagcagtttagcgtgatgcgttaccactcgctatatgtagataaggacaccttgcca
caggaacttatcattactgccctctcggacgatgaggtgattatggcattacaacacaaa
acaaaacctattcacagtattcaatttcaccctgaatcattttttactgaatatggcaaa
aatatccttaagaactttttgataggaacacaagctgttcaaagcgttcaaaatactcag
gaaaaagccaaagcctacgccaatgaagtgttcaaaacagctttgaagaaactgcaagaa
aatcagccgttaggcgatagcgatttcaaacagatatgtggggtattgcacagcaagcag
tacgacatcgtacaattaggcgcgctcttcgtgcttatcagtgaaaaaagtttatatcca
gaatcacttactgccttcgtgcgcaacatcttggcatatagcaccacctttgccgaccca
agacctatgatagacctctgtggtacaggaggcgacggactcaaaactattaacatttct
accacggtagcctttatagtagctgccttaggggtgaaagtagccaaacacggcaacagg
tcggttacaagccagagtggcagtaccgatgtgttaggagagcttggtattgcgatggaa
agcaacttgatgaagcaattagatagcttggagaaaaacggattagcattcttccacgcg
cctttcttccataacttagtaggcgaagtacgtgaagtgcgacaacgtttgggcatccgc
acggtgttcaatgtattaggacctctgttacaccccaatacaaaactgaaataccaatta
gtaggtttatatcacgagcccgtgatgcgcctatatgccgaaacactacagcttttagga
cgcgaacacgctttagtagtgcgtggcaatgatggtttagatgaaataagtatttgtgat
gagacaaaaattgtagaggtaaagggtaagcaaatattagagtataccatagcgcctgaa
atgtttggctttaagcgtgcttttcacactgatatacaaggtggcacacctactgaaaac
gctgagatactacgtcgcactctcaaaggtgaagagcgcggtgctaaagctgatatcgtg
atactcaacgcaatgtttgctctctataccgccaatgtagtaaaacagcccgctgaagct
aaacctcttattgaagaagctttaaggagtggaaaagtgtggcaattagttagcaaatta
gttaattag

DBGET integrated database retrieval system