KEGG   Clostridium scatologenes: CSCA_0019Help
Entry
CSCA_0019         CDS       T03803                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
csq  Clostridium scatologenes
Pathway
csq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CSCA_0019
Enzymes [BR:csq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CSCA_0019
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CSCA_0019
    1.1.1.-  
     CSCA_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ThiF 2-Hacid_dh_C Nucleoplasmin Gp_dh_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AKA67144
UniProt: A0A0E3M470
Position
22370..23386
Genome map
AA seq 338 aa AA seqDB search
MKKMKQVWFADENKVEVRNVEIPKVAANQVKVKIAYAALCATDVHMVTMGVLGAKPPMRL
GHEASGIIEELGQGADKFGFKIGDKVSLFPVTSCGKCPACKKGQPQYCHNSQDTGAFAEY
AVTDVSAVFKIPDDADLQWYSLVEPANCTIRAMDLAKIKHGDTVAISGVGGIGSILLNMI
LLAGGAKVTAIDPVESKRQMALNMGAQYVIDPFNEDMEKRAMEITDGNGFDYVFEASGSP
KAAEPALKIMGKCGTVVYFAVFPPKYEMPLNLYELYMKEGRIQTVFTTTSIMPRTINLIP
RLQLDKVIGKVMPLSDAVKGFELFNKSIYPKILFDCSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatgaaacaggtatggtttgcagatgaaaataaggtagaagttcgtaatgtg
gaaattccaaaagtggctgcgaatcaggtaaaggtgaaaattgcatatgctgctctttgt
gcaacagacgtgcatatggtaactatgggagtattaggtgccaagccgccaatgcggctt
ggtcatgaagcatccggtattattgaagagttaggccagggagctgacaagtttggattt
aaaattggagataaggtttcgctttttccagtaacaagttgtggaaaatgtccagcctgt
aaaaaaggacagccccaatactgtcataattctcaggatacaggtgcttttgcagaatat
gcggtgactgatgtcagtgctgtttttaagattccagatgatgctgatttacaatggtac
agtttagtagaaccggcaaattgtaccatacgcgctatggacttagcgaaaataaaacat
ggtgatacggttgcaatttcaggcgtaggtggtattggttctattcttttaaatatgatt
ttacttgcaggtggtgcaaaggtaactgctatcgatcctgtagaatctaaacgtcaaatg
gcacttaatatgggagcacagtatgtgattgacccatttaatgaagatatggaaaagcgt
gcaatggaaattacagatggtaatggctttgattacgtatttgaggcatcaggttctcct
aaagcggcagaaccagcactgaaaattatgggcaaatgtggtacagtagtttactttgca
gtatttccacctaaatatgaaatgccacttaatctctatgaactatatatgaaggaaggt
aggattcaaacagtatttactacaacttcaattatgcctcgtaccatcaatcttatccca
agattacagcttgataaggttattggcaaggtgatgccgctgagtgatgcagtgaaaggg
tttgaactgtttaataaatcaatttatcctaagattttatttgattgctctaaataa

DBGET integrated database retrieval system