KEGG   Clostridium scatologenes: CSCA_0124
Entry
CSCA_0124         CDS       T03803                                 

Definition
(GenBank) D-ornithine 4,5-aminomutase E subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
csq  Clostridium scatologenes
Pathway
csq00472  D-Arginine and D-ornithine metabolism
csq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CSCA_0124
Enzymes [BR:csq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CSCA_0124
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding AA_kinase
Other DBs
NCBI-ProteinID: AKA67249
UniProt: A0A0E3JWI5
Position
133858..136062
AA seq 734 aa
MIEKLKENEKLNVEEILKDLDKYEPKWRGWHWREPYKEGKVGEFTYHEISKPLKNSQPLP
AARSFQGIDPQPRAVITTEIASGRFEDDLRRMRMAAWHGADHLMVIRTAGQSHYDGLIEG
TPEGIGGVPITRKEVRATRKAIDLIEEEVGRKINFHSYVSGVAGPDIAVMFAEEGVNGAH
QDPQYNVLYRNINMYRSFVDAAVAKRIMVWADMLQIDGAHNANATAMKGYNVMPELMVQH
AINSKFSEMIGMKPENISLSTVPPTSAPAPCMRYDLPYAVALRQLFDKYKMRAQMNTKYI
ESCEREATVGHTLNLLISELTSVDIQSTITPDEGRNVPWHYNNIHAVNTTKQSFLAMDGL
MDMIELKKTGYLPEKVRELKERAVLFLEEMIEVGGYFKAVDSGFFIDSGQYPERNGDGIA
RKMEGGDAVGTIVKREEDYFAPVCAHFGYNNVPKEYKKPCDAIDKCTLCDHSKIKYIDEL
DENDNVFKRMEKVKEDGTIVPEVQWAKDGYLKVTLCIPENEQISEAAALEIGKRMNLKDV
EIIHKQVLQKSEGTLVEIKGVCDFKPVKRDELTLPKRRKTLSAEVMRNYVKEHPIKVVAA
TVGEDEHSVGLREIIDIKHGGVERFGIEAIYLGTSCPVEKLVDAAIESKAQAILCSTIIT
HNDVHTKNMQKLNDLCVEKGVRDKLILVSGGTQVTDEIAKDHGMDVGFGRGSNGTDVASF
IIKKLMGLNPDEEE
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgattgaaaaattaaaagaaaatgaaaagcttaatgtagaagaaatattaaaagattta
gataaatatgaaccaaagtggagaggctggcattggagagaaccttataaagaaggaaaa
gttggagaatttacctatcatgaaatatctaaacctttaaaaaatagtcagccacttcca
gcagcaagaagttttcagggaatagatcctcagccaagagctgttattactacagaaata
gcttcaggaagatttgaagatgatttaagaagaatgagaatggcagcctggcatggagct
gatcacttaatggttataagaacagcaggacaaagccattatgatggattaatagaagga
acaccagagggaataggaggagttcctattacgaggaaagaggttagagctacaagaaaa
gctatagatttaatagaagaagaagtaggaagaaaaatcaattttcattcttatgtatcc
ggtgtagcaggtccagatattgcagttatgtttgcagaagaaggggtaaatggagctcat
caagatcctcaatataatgtgctttatagaaatataaatatgtatagatctttcgtagat
gctgcagtagctaagaggataatggtatgggcagatatgcttcagatagatggtgctcat
aatgccaatgctacagctatgaaaggatataatgtaatgcctgaacttatggttcaacat
gctataaattcgaaattttcagaaatgattggaatgaaaccagagaatatatcactttct
acagtgccaccaacatcagcaccagctccttgtatgagatatgatttaccttatgcggtg
gctttaagacaattattcgataaatacaaaatgagagctcaaatgaacactaaatatata
gaatcttgtgaaagggaagctacagtaggacatactttgaatttgttaatttcagaacta
acttcggtagacattcaaagtactataactcctgatgaaggaagaaatgttccatggcat
tataataatatacatgctgtaaatacaacaaagcaatcatttttagctatggatggacta
atggacatgatagaacttaagaaaactggctatttacctgaaaaagtaagagagcttaaa
gaaagagcagttttattcttagaagaaatgatagaagttggcggatattttaaagcagtt
gatagtggtttctttatagattcaggacagtatccagagagaaatggagatggcattgca
agaaaaatggaaggcggagatgctgtaggaactatagtgaaaagagaagaagattatttt
gctccagtttgcgcacattttggatataacaatgtacctaaggaatataaaaagccttgc
gatgctatagataaatgtactttatgtgatcattcaaaaattaaatatatagatgaacta
gatgaaaatgacaacgtattcaagagaatggaaaaggttaaagaagatggtactatagtg
ccagaagttcaatgggctaaggatggatatttaaaagttaccttatgtatacctgaaaat
gaacaaattagtgaagcagcagccttagaaattggaaagagaatgaatttaaaggatgtg
gaaattatacacaaacaagtacttcaaaaatctgaaggaactttagttgaaattaaagga
gtgtgtgattttaaacctgtaaagagagatgaacttactcttccaaaaagaagaaaaact
ctttcagcagaagtaatgagaaattatgtaaaggaacatcctataaaggttgttgcagct
actgttggagaagatgaacattctgttggactgagagaaattattgatattaaacatggt
ggtgtagaaaggtttggtatagaggcaatatatcttggaacttcatgtcctgtggaaaag
cttgtagatgcagctatagaatcaaaagctcaagctatattatgcagcacaataattact
cataatgatgtgcatacaaagaatatgcagaagttgaatgatttatgtgtagaaaaaggt
gtaagagataaattaattcttgtatctggtggcactcaagtaacagatgaaatagctaag
gatcatggcatggacgttggttttggaagaggctctaatggtacagatgttgcatctttc
ataattaaaaaattaatggggcttaatccagatgaagaagaataa

DBGET integrated database retrieval system