KEGG   Clostridium scatologenes: CSCA_2538Help
Entry
CSCA_2538         CDS       T03803                                 

Definition
(GenBank) glycoside hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
csq  Clostridium scatologenes
Pathway
csq00460  Cyanoamino acid metabolism
csq00500  Starch and sucrose metabolism
csq01100  Metabolic pathways
csq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSCA_2538
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CSCA_2538
Enzymes [BR:csq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CSCA_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: AKA69663
UniProt: A0A0E3M9I8
Position
complement(2787292..2789343)
Genome map
AA seq 683 aa AA seqDB search
MLTKQTRSKFNEEAKEIVSKLTLEEKVHLMSGSVTFNDMMEDLDAHNKNKHYNWKVYEAG
GNEQMGIPKLGFCDGPRGVVTGQSTCFPVTVARGATFNKMLEERVGIAIAQEIRGYGGNF
YGGVCINMPYSPGWGRSQETYGEDSFHLGAMGGSLVKGIQSQGVIACIKHFAFNSMENAR
FKVSVAADKRTEREIFLAHFKDCIDAGAAAVMTAYNKYKGDHCGENSYLIDVLRKEWGYD
GIIVSDFGWGIYDTVKAANAGMNVEMCNTSVFGRKLVKAVQDGKVSEKVINDSAINIIRT
LLAFKKNPDPINYTKENLIANDEHINLAKIVAEESCTLVKNDGILPFNNSKNEKILILGR
LAGIANLGDHGSSEVFPPYSVTIKDGLIAKSEGTIGFYDGRDIEKAKKLALDYDKVIFVV
GYDYKNEGEYIEDGDFKIGGDRKDGFGLEQYDRDLIEKVSEVNKENVTLIVSGSMITLDK
WADSTKAIMYTYYSGMEGGSAIAEVLFGDVNPSGKLPFVIPKNENDLPQVNWTSEEQRYE
YYHGYMRLEKYNKECKYPYGFGLSYTKFNISQPQIELKSDSIVASCIVTNIGSRKGKEVV
QLYVGYDNSKVDRAVKTLKGFEKVELYPGESKTVKIICPLDKLKYYKEKENKWILEPMLY
QGYIGSSSDKKDLFEVDFEIQKY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaaaacaaactagaagtaaatttaatgaagaagccaaagagatagtatctaaa
ttgacactggaagaaaaagttcatttgatgagtggtagtgttacttttaatgatatgatg
gaagatttagatgctcacaacaagaataaacactacaactggaaggtttatgaagctggt
ggaaatgaacaaatgggtattcctaaacttggattttgtgatggaccaagaggagttgta
acaggtcaaagtacatgttttccagtaacagttgctcgtggtgcaacatttaataaaatg
cttgaagaaagagttggaattgccattgctcaagaaatccggggatatggtggaaatttt
tatggaggtgtttgcatcaacatgccatatagcccaggatggggaagaagtcaagagact
tatggtgaagattccttccacttaggtgcaatgggaggttccttagttaagggtatccaa
tcacaaggtgtcattgcctgcatcaaacattttgcctttaacagtatggaaaatgcaaga
tttaaagtaagtgtagctgcagataaaagaactgaaagagaaatatttctagcacacttc
aaggattgtattgatgctggagcagctgctgttatgacagcctacaataaatataaggga
gaccattgtggagaaaactcatatttaattgatgttttgagaaaagaatggggatatgat
ggtattattgtaagcgactttggatggggcatatatgatacagtcaaagctgctaatgca
ggaatgaatgttgagatgtgtaatactagtgtctttggaagaaagcttgtaaaagcggta
caagatggaaaggtgtccgaaaaagtaattaatgattctgcaattaatattatccgtaca
ttattagcattcaaaaaaaatccagaccctattaattatacaaaagagaatttaattgct
aacgatgaacatattaatttggctaaaattgttgcagaagaatcttgtacattagttaaa
aatgatgggattttgccatttaataattcaaaaaatgaaaaaattctaattttaggaaga
ttagctggtattgcaaatttaggtgatcatggttcaagtgaagtatttcctccttattca
gttacaataaaagatggattaattgctaagtctgaaggaacaattggattttatgatggt
agagatattgaaaaagcaaaaaaattggcattggattatgacaaagttatttttgtagta
ggttatgattataaaaatgaaggtgaatatattgaagatggagattttaaaataggtggg
gatagaaaagatggctttggcttagaacaatatgatagggatttaatagaaaaagtttct
gaggttaataaagaaaatgttactctaatagtaagtggaagtatgattacccttgataaa
tgggcagattctacaaaagctattatgtacacttattattctggaatggaaggtggttct
gctattgcagaagttttatttggggatgtaaatccttcaggaaaacttccatttgttatt
cctaaaaatgaaaatgatttaccacaagttaattggacatctgaagaacaaagatatgaa
tattatcatggatatatgagacttgagaaatataataaagaatgtaaatatccatatgga
tttggtttgagttatacaaaattcaatatttcacagcctcaaattgaattgaaatcagat
tctatagtagcttcttgtattgttaccaatataggatcaagaaaaggcaaagaagtagtt
cagctttatgttgggtatgataactcaaaagttgatagagcagtaaaaacattaaaagga
tttgaaaaagtggaattatatccaggagaaagtaaaactgtaaaaattatatgtccatta
gacaagctaaaatattacaaagaaaaagaaaataaatggatattagaacctatgttatat
caaggatatattggatctagttctgataaaaaagatttatttgaagtggactttgaaatt
caaaaatattaa

DBGET integrated database retrieval system