KEGG   Clostridium scatologenes: CSCA_3690Help
Entry
CSCA_3690         CDS       T03803                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csq  Clostridium scatologenes
Pathway
csq00071  Fatty acid degradation
csq00280  Valine, leucine and isoleucine degradation
csq00310  Lysine degradation
csq00362  Benzoate degradation
csq00380  Tryptophan metabolism
csq00620  Pyruvate metabolism
csq00630  Glyoxylate and dicarboxylate metabolism
csq00640  Propanoate metabolism
csq00650  Butanoate metabolism
csq00900  Terpenoid backbone biosynthesis
csq01100  Metabolic pathways
csq01110  Biosynthesis of secondary metabolites
csq01120  Microbial metabolism in diverse environments
csq01130  Biosynthesis of antibiotics
csq01200  Carbon metabolism
csq01212  Fatty acid metabolism
csq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSCA_3690
   00630 Glyoxylate and dicarboxylate metabolism
    CSCA_3690
   00640 Propanoate metabolism
    CSCA_3690
   00650 Butanoate metabolism
    CSCA_3690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSCA_3690
   00072 Synthesis and degradation of ketone bodies
    CSCA_3690
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSCA_3690
   00310 Lysine degradation
    CSCA_3690
   00380 Tryptophan metabolism
    CSCA_3690
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CSCA_3690
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSCA_3690
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSCA_3690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csq04147]
    CSCA_3690
Enzymes [BR:csq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CSCA_3690
Exosome [BR:csq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSCA_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF2656
Motif
Other DBs
NCBI-ProteinID: AKA70815
UniProt: A0A0E3M7K0
Position
complement(3975849..3977027)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVSAVRTAIGKFGGALKDVTTVDLGSIVIKEAVKRAGIKPEQVGEVMMGCVYQAG
LGQNAARQASVQAGIPVEVPAMTVNILCGSGLRTVSLAAQIIKSGDEDIIVAGGMDNMSR
TPYVLQSGRWGQRMGATEMQDSLLHDGLFDAFNNYHMGMTAENIADQWHITREEQDAFSV
NSQNKAEAAIKAGKFKDEIVPVVIKTRKGEVIFDTDEGPRPGTTIEALAKLKPAFKKGGT
VTAGNASGINDAASALVIMSADKAKELGLKPMAKIVSYGTKGLDPAIMGYGPFHSTKLAL
ERAGMTVDDLDLIEANEAFAAQSLAVARDLKFDMSKVNVNGGAVALGHPVGCSGARILTT
LLYEMQKRGSKKGLATLCIGGGMGTSVIVERC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttatagttagcgcagttagaactgctataggtaaatttggaggagca
ttaaaagatgtaacaactgttgatttaggatctattgttattaaagaagctgtaaaaaga
gcaggaataaaaccagaacaagttggagaagtaatgatgggctgtgtatatcaagcagga
cttggacaaaatgcagctagacaagcatcagttcaagctggcattccagtagaagttcca
gctatgacagtaaatatactttgtggttcaggtcttagaactgtaagtttggcagcacaa
ataataaaatcaggtgacgaagatattatagttgcaggtggaatggacaatatgtcaaga
actccatatgtacttcaatcaggaagatggggacaaagaatgggagcaacagaaatgcaa
gattctttacttcatgatggtctatttgatgcatttaataattatcatatgggaatgact
gctgaaaatatagcagatcaatggcatataacaagagaagaacaagatgccttttcagta
aattcacaaaataaagcagaagcagcaataaaagcaggaaaatttaaagatgaaatagtt
cctgtagttataaaaactagaaaaggtgaagtaatatttgatacagatgagggaccaaga
ccaggaacaactattgaagcattagctaaattaaaaccagctttcaaaaaaggtggaaca
gttacagcaggaaatgcttcaggaataaatgatgcagcatcagcactagtaattatgagt
gctgataaagcaaaagaattaggattaaaacctatggctaaaatagtttcttatggaaca
aaaggattagatccagcaataatgggatatggtccattccattctactaaacttgcttta
gaaagagctggtatgacagtagatgatttagatttaatagaagcaaatgaagcttttgca
gctcaaagtttagcagtagcaagagacttaaaatttgatatgagcaaagttaatgtaaat
ggaggagctgtagcattaggtcatccagtaggatgctctggagctagaattttaactaca
cttttatatgaaatgcaaaaaagaggttctaaaaaaggcctagcaactttatgcataggt
ggaggaatgggaacatctgtaatagttgaaagatgctaa

DBGET integrated database retrieval system