KEGG   Clostridium scatologenes: CSCA_3901Help
Entry
CSCA_3901         CDS       T03803                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csq  Clostridium scatologenes
Pathway
csq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:csq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CSCA_3901
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:csq03400]
    CSCA_3901
Enzymes [BR:csq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CSCA_3901
DNA repair and recombination proteins [BR:csq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CSCA_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 Helicase_RecD PIF1 PhoH AAA_22 UvrD_C DEAD DNA_pol_lambd_f T2SSE DUF853 AAA AAA_23 HHH_2 AAA_12 DUF2075 SRP54 AAA_28 RsgA_GTPase AAA_29 NTPase_1 Mg_chelatase AAA_16
Motif
Other DBs
NCBI-ProteinID: AKA71026
UniProt: A0A0E3GRW4
Position
complement(4216918..4219173)
Genome map
AA seq 751 aa AA seqDB search
MQQIQGVVENIVFQNEENGYAVAKIKEKSESITIVGCIPFIMEGQNLKLIGEWVLHPQFG
QQFKVSGCEEIVPNSIVGIERYLSSGIISGIGPVTAKKIVEKFGEKTLDILDNHIERLKE
IEGIGAKKIALIDASYSKQNEVRNIMVFLQTYGVTPNQCVKIHKRFGTESIKIVKENPYI
LTEEISGIGFKTSDKIARSLGIDVNSPFRIQSGIRYIINQFCGLGNTYMPLEKLLKEGIS
ILGVTKEKIEENIYDSSINGKLKLEKFEDKLCVFTIPYYYCELGVTKKILTLAVNDYGGM
KINVDEEIESFENDNCIKFADSQKEAIKGAVENGVEIITGGPGTGKTTIINCITEIFEKL
KLRVFMAAPTGRAAKRMTEATGREAKTIHRLLEMGVGDEEEPSMLFSKGENSPLECDVII
IDEASMIDIMLMNNLLKAVDVSTRIIIVGDVDQLPSVGPGNVLRDLIESRCIKVVRLKEI
FRQSTESMIVVNAHKINNGEMPLMNQKNKDFYFIKCEDVDKITDTLISLVDKRLPNFNKK
WNKINDIQILSPMRKGVLGVSNLNKKLQDILNPKAQNKKEKEFRDTVFRVGDKIMQTKNN
YSLKWTRVSGEGECEGVGIFNGDVGFIQDIDEDKDTVDIIFDDERKVIYDNMYLDEIDLA
YAVTIHKSQGSEFPVVIIPMYMGAPLLMNRNLLYTAITRAKQLVVLVGELKAIKFMIDND
RSFERYSLLKHRIMDIMESEVNVVVSEDEVE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaatacaaggtgtagttgaaaatatagtttttcaaaatgaggaaaatggatat
gctgtggcgaaaattaaagagaaaagtgaaagtataactatagtaggatgtatacctttt
attatggagggtcaaaatttaaagcttataggtgaatgggttcttcatccacaatttgga
cagcaatttaaagtttctggatgtgaagaaatagttcctaattctatagttggtatagaa
agatatttatcatcaggaataatatctggtattggacctgttacagctaaaaaaatagta
gaaaagtttggtgaaaagactttagatatattggataatcacatagaaaggcttaaggaa
atagaaggtataggcgcaaaaaaaatagcgttaatagatgcttcttattctaagcaaaat
gaagtaagaaatataatggtttttttgcagacttatggagtcactccaaaccaatgtgtt
aagatacataaaaggtttggaacagaatctataaaaattgtaaaagaaaatccatatata
ttgacagaagaaatatctgggataggatttaaaacatcagataagattgcaagaagtctt
ggtatagatgtaaattctccttttagaatacaaagtggaataaggtacattataaatcaa
ttttgtggccttggaaatacatatatgccgttagagaagttacttaaagagggaattagt
atattaggagtgactaaagaaaaaattgaagagaatatatatgatagctctataaatgga
aaactaaagttggaaaaatttgaagataaattatgtgtatttacaattccatactattat
tgtgagcttggagttacaaaaaagatactcactttagctgtaaatgattatggtggtatg
aagataaatgtagatgaagaaatagagagttttgaaaatgataattgtataaagtttgcg
gattcacaaaaagaagctataaaaggtgccgtagagaatggagttgaaataataactggg
ggaccaggtacaggaaaaactactattataaattgtataacagaaatatttgaaaaactt
aagcttagggtctttatggcagcaccaacaggaagagctgctaaaaggatgacagaagct
acaggacgtgaagctaaaacaattcataggcttttggaaatgggagtaggagatgaagaa
gaaccaagtatgctattttctaaaggtgaaaattctcctttagagtgtgatgtcattata
atagatgaagcttccatgatagatattatgcttatgaataaccttttgaaggcagttgac
gtaagtacaagaattataattgtaggagatgtagatcaacttccatcagtaggtcctgga
aatgtattgcgtgatttaattgaaagcagatgtattaaggttgttaggctcaaggaaatt
tttagacaatcaacagaaagcatgatagtagttaatgcacataaaattaataatggagaa
atgcctttaatgaatcaaaaaaacaaggatttttatttcataaaatgtgaagatgtagat
aaaataacagatacattaatatctcttgtagataaaagactgcctaactttaataaaaaa
tggaataaaatcaatgatatacagatactttcacctatgagaaaaggggttttgggagtt
tctaatctaaataaaaaacttcaggatattttaaatcctaaagctcaaaataaaaaggaa
aaagaatttagagatacagtatttagggtcggagataaaataatgcaaacgaaaaataat
tattccttgaaatggactagagtttcaggagaaggtgaatgtgaaggagtaggcattttt
aatggagatgttggatttatacaggatatagatgaagataaggatactgtagatataata
tttgatgatgaaagaaaagttatatatgacaacatgtatttagatgaaattgatttagct
tatgctgtaactatccataagagtcagggaagtgaatttcctgtagttattatacctatg
tatatgggtgcgccattattaatgaatagaaacttattgtatacagctattactagagcc
aaacaattagttgttttagtaggagaattaaaagctataaaatttatgatagataatgat
agaagttttgaaagatattcgttattaaaacatagaataatggatataatggagagtgaa
gtaaatgttgttgtttcagaagatgaggttgaataa

DBGET integrated database retrieval system