KEGG   Clostridium scatologenes: CSCA_4328Help
Entry
CSCA_4328         CDS       T03803                                 

Definition
(GenBank) Methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
csq  Clostridium scatologenes
Pathway
csq00630  Glyoxylate and dicarboxylate metabolism
csq00660  C5-Branched dibasic acid metabolism
csq01100  Metabolic pathways
csq01120  Microbial metabolism in diverse environments
csq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CSCA_4328
   00660 C5-Branched dibasic acid metabolism
    CSCA_4328
Enzymes [BR:csq01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     CSCA_4328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C MR_MLE_N Flp_N
Motif
Other DBs
NCBI-ProteinID: AKA71453
UniProt: A0A0E3M9V7
Position
4659840..4661081
Genome map
AA seq 413 aa AA seqDB search
MKIVDVICSESKTGFYFDDQRAIKKGAGHDGFTYVGEPVTEGFKNVRQAGEAISVMLILE
DGQVAYGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGRELKEFKALAEEFDKMQ
VNGKRLHTAIRYGVTQAILDAVAKAQKLTMAEVIRNEYNSGYEINRVPIFTQSGDDRYDN
SDKMIIKGADVMPHALINNVEEKLGLKGEKLLKYVEWLRDRVIKLRTKEDYSPIFHIDVY
GTIGAAFNYDTKAMADYIKTLEEAAKPFHLRIEGPMDVEERQKQMEAMRDLRAELDGRGI
NVELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKEHDMGAYCGGT
CNETNRSAEVTTNIGMACGAKQVLAKPGMGVDEGYMIVNNEMNRVIALVNRRK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagttgacgttatttgttcagaatcaaaaacaggattttattttgatgatcag
agagctataaaaaaaggagcaggtcatgatggattcacttatgtaggagaaccagtaaca
gaaggatttaaaaatgttagacaggcaggagaagctatatctgtaatgcttatattagaa
gatggtcaggtagcatatggagattgtgcagcagtacaatattcaggagcaggcggaaga
gatcctttatttttagctaaagattttattccagttatagaaaaggaaatagcgcctaag
cttataggaagggaattaaaggaattcaaagcactagcagaagaatttgataaaatgcag
gttaatgggaaaagattacatacagctataagatatggagtaactcaagcaatacttgat
gcagtagcaaaagctcaaaaattaactatggcagaagtaataagaaacgaatacaattca
ggttatgaaataaatagagttccaatatttacacaatcaggagatgacagatacgacaat
tcggataaaatgataataaagggtgcagatgtaatgcctcatgcacttataaataatgta
gaagaaaaattaggattaaaaggtgaaaaactattaaagtatgttgaatggttaagagat
agagtaataaaattaagaactaaggaagattatagtccaatattccatatagatgtatat
ggaacaataggtgctgcatttaattatgatacaaaagcaatggctgattatataaaaaca
ctagaagaagcagcaaaaccattccatttaagaatagaaggaccaatggatgtagaagaa
agacaaaaacaaatggaagcaatgagagacttgagagcagaattggatggaagaggaata
aacgtagaattagttgcagatgaatggtgcaacacagtagaggatgtaaaattctttaca
gacaataaagcaggacatatggtacaaataaagacaccagatttaggtggagtaaataat
atagcagatgcaataatgtattgtaaagaacatgatatgggagcatattgtggaggaacg
tgtaatgaaacaaatagatcggctgaagtaactacaaatataggtatggcttgtggcgca
aaacaggtactggctaaaccaggaatgggcgtagatgaaggatacatgatagttaataat
gaaatgaatagagttattgcacttgtaaatagaagaaaataa

DBGET integrated database retrieval system