KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c00660Help
Entry
Cspa_c00660       CDS       T02467                                 

Gene name
metG1
Definition
(GenBank) methionine--tRNA ligase MetG
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00450  Selenocompound metabolism
csr00970  Aminoacyl-tRNA biosynthesis
csr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cspa_c00660 (metG1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cspa_c00660 (metG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csr01007]
    Cspa_c00660 (metG1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csr03016]
    Cspa_c00660 (metG1)
Enzymes [BR:csr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Cspa_c00660 (metG1)
Amino acid related enzymes [BR:csr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cspa_c00660 (metG1)
Transfer RNA biogenesis [BR:csr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cspa_c00660 (metG1)
 Prokaryotic type
   Other AARSs
    Cspa_c00660 (metG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DALR_2 DNA_ligase_ZBD DALR_1 zf-Mss51 DUF1272
Motif
Other DBs
NCBI-ProteinID: AGF53901
UniProt: M1MFZ6
Position
73354..75291
Genome map
AA seq 645 aa AA seqDB search
MCTDCKKTYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGYDVMFLTGTDEHGQKI
QRIAEEKGITPKEHVDEVVAGIKDLWSMMNISYDKFIRTTDDYHIKAVQDIFKKLYDQGD
IYKSSYEGWYCTPCESFWTDTQLVDGNCPDCGRPVEKSKEEAYFFKMSKYADRLIKYIED
HPDFIQPESRKNEMLNNFLRPGLQDLCVSRTSFNWGVPVTFDESHVVYVWIDALSNYITA
LGYGQDNKELYDKFWPADVHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGG
KMSKSKGNVVDPVVLVNEFGVDPVRYYLLKEIPFGADGLFNNEIFIKKINSDLCNDLGNL
LSRTVAMVEKYFAGEMPAQVEKEAIDDELISLALAAPGKIEAAVNELNIPQALEYVFELI
GRANKYIDETTPWILAKDEAKKARLGTVLYNLAESLRFASVMISAFLPDTAKKINEQINT
SEIAWESLKAFDGTKAGTKVVKTENLFPRIDVDKKLAELEALRAASQPAKREITPIKEEI
TIEDFEKIDLRVVKVLACEQIKGAKKLLKLKVDLGGEERQVVSGIAVHYKPEELVGKNVV
LVANLKPVKLRGELSQGMILCAATDDDSVLKAVDPGDLESGSIVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacagattgtaaaaaaacatattatattactacaccaatttattatccatcaaca
aagctacatataggaaatacttatactactgtagctgcggatgcacttgcaagattcaaa
agattaacaggctatgatgtaatgtttttaacaggaacagatgaacatggtcaaaagatt
caaagaatagctgaagaaaagggaattacaccaaaagagcatgtagatgaagttgttgct
ggtattaaggatctttggagcatgatgaatataagttatgataagttcattagaactact
gatgattatcatattaaagctgttcaagatatatttaagaaattatatgatcaaggagat
atctataagagttcttatgaagggtggtattgtacaccttgtgaatcattttggactgat
actcaattggtagatggaaactgtcctgattgtggaagaccagttgaaaaatcaaaggaa
gaagcttatttctttaaaatgagtaaatatgcagatagattaataaaatatattgaagat
catccggatttcattcaaccagaatcaagaaagaatgaaatgttaaataacttcttaaga
ccaggtcttcaagatctttgcgtatcaagaacaagctttaactggggagttcctgtaact
tttgatgaaagtcatgttgtgtatgtttggatagatgcattatcaaactatataactgct
cttggatatggtcaagataacaaagaattatacgataaattctggccagcagatgtgcat
ttaataggaaaagatattttaagattccatactatttattggccaattatgttaatggca
ttagatttaccacttccaaagcaagtatttgggcatggatggcttcttgttgatggtgga
aagatgtcaaaatctaaaggaaatgtagttgatccggttgttcttgtaaatgaatttgga
gtagatcctgtaagatattatttattaaaggaaattccatttggagcagatggattattt
aataatgagatatttataaagaagataaattctgacctttgtaatgacttaggtaatctt
ttatcaagaacagttgcaatggttgaaaaatattttgctggagaaatgcctgcacaagtt
gaaaaagaagctattgatgatgaattaataagtttagctttagcagcgccaggaaaaatt
gaagcagcagttaatgaattaaatataccacaagctttagaatatgtatttgaattaata
ggaagagcaaataagtatatagatgaaacaactccatggatattagctaaggatgaggct
aaaaaagctagacttggaacagttctttataatttagctgaaagtcttagatttgcatca
gtaatgatttcagccttcttaccagatacagctaaaaagatcaatgaacaaataaatact
tcagaaatagcatgggaatcactaaaagcatttgatggaacaaaggctggaacaaaagtt
gttaaaactgaaaacttatttccaagaatagatgttgataaaaagcttgcagaattagaa
gctttaagagcggcatctcaaccagctaagagagaaataactccaattaaagaagaaatc
acgattgaagattttgaaaaaattgatttaagagttgttaaagtattagcttgtgaacaa
ataaaaggagctaaaaaattattaaaattaaaagtggatttaggtggagaagaaagacaa
gtggtttcaggaatagcagtccactataaaccagaagaattagttggaaaaaatgttgtg
ctagtagctaatttaaaacctgtaaaacttagaggtgaattatcacagggaatgatttta
tgtgctgcaacggatgatgatagcgtgttaaaggctgtagatccaggagatctagaatca
ggaagcatagtaagataa

DBGET integrated database retrieval system