KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c16370Help
Entry
Cspa_c16370       CDS       T02467                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase LtaE
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00260  Glycine, serine and threonine metabolism
csr01100  Metabolic pathways
csr01110  Biosynthesis of secondary metabolites
csr01120  Microbial metabolism in diverse environments
csr01130  Biosynthesis of antibiotics
csr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cspa_c16370 (ltaE)
Enzymes [BR:csr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Cspa_c16370 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGF55407
UniProt: M1MV66
Position
1809415..1810434
Genome map
AA seq 339 aa AA seqDB search
MYSFKNDYSEGAHERILNALVESNFEQTDGYGEDYHTERAVQILKDKIDNQNVDIHLLVG
GTQVNLTAISAFLRPHQAAIGADTSHINCHETGAIEATGHKVITMKTDDGKLTPSLIQKV
VDAHQDEHMVQPKLVYISDSTELGTLYTKAELTDLHNCCKKNKLLLYLDGARLGAALTAE
KNDLTLADIAKLVDAFYIGGTKNGALFGEALVICKDELKEDFRYFIKQKGGLLAKGRLLG
IQFEELFKDDLYFELAKYANNLAIILKNALIEKGYKFLCESYTNQQFPILPNEVVKKISE
KYSFNVERVIDENNTVIRLVTSWATSKEKVLEFVEELNL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtacagttttaaaaatgattatagtgaaggtgctcatgaaagaatattaaatgcactg
gttgaaagtaattttgaacaaacagatggctatggtgaggactatcatacagaaagagca
gttcaaatattaaaggataaaatagataatcaaaatgtagacattcatttacttgtaggt
ggcactcaagttaatcttacagcaatatcagcattcttaagacctcatcaagcagcaata
ggagcagatacaagtcacattaattgtcatgagacaggagcaattgaggcgacaggacat
aaggtaataacaatgaaaacagatgatgggaaattaacaccaagtttaattcaaaaggtt
gtggatgcacatcaagatgaacatatggttcagccaaagcttgtttatatttctgattcc
acagaacttggaactttatatacaaaagcagaattaactgatttacataattgttgtaag
aaaaataaattattattatatttagatggtgctagacttggagcagctcttacagcagaa
aaaaatgatttaactttggctgatatagctaaattagttgatgcattttatattggagga
actaaaaatggagcactttttggagaagcgcttgtaatatgtaaggatgagttaaaagaa
gattttagatattttattaagcaaaagggtggacttttagctaagggaagattgcttgga
attcaatttgaagaattattcaaagatgatttatattttgaattggcaaaatacgcaaat
aatctggctataatattaaaaaatgcattaatagaaaaaggctataagtttttatgtgaa
tcttatactaatcaacagttccctattttacctaatgaggttgtaaaaaaaataagtgaa
aaatattcttttaatgttgaaagagtaattgatgaaaacaatactgtgattagattagta
acctcttgggcaacaagtaaagaaaaagtattagaatttgtggaagaactaaatttatag

DBGET integrated database retrieval system