KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c20900Help
Entry
Cspa_c20900       CDS       T02467                                 

Gene name
bcd3
Definition
(GenBank) acyl-CoA dehydrogenase, short-chain specific
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00071  Fatty acid degradation
csr00280  Valine, leucine and isoleucine degradation
csr00410  beta-Alanine metabolism
csr00640  Propanoate metabolism
csr00650  Butanoate metabolism
csr01100  Metabolic pathways
csr01110  Biosynthesis of secondary metabolites
csr01120  Microbial metabolism in diverse environments
csr01130  Biosynthesis of antibiotics
csr01200  Carbon metabolism
csr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Cspa_c20900 (bcd3)
   00650 Butanoate metabolism
    Cspa_c20900 (bcd3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cspa_c20900 (bcd3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cspa_c20900 (bcd3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cspa_c20900 (bcd3)
Enzymes [BR:csr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Cspa_c20900 (bcd3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_ox_N
Motif
Other DBs
NCBI-ProteinID: AGF55856
UniProt: M1MM70
Position
2302413..2303552
Genome map
AA seq 379 aa AA seqDB search
MNFKLTREQELVQQMVREFAVNEVKPIAAEIDETERFPMENVEIMAKLGMMGIPFSKEFG
GAGGDVLSYIIAVEELSKVCGTTGVILSAHTSLCASVINENGTKEQREKYLPDLCSGKKI
GAFGLTEPGAGTDAAGQQTTAVLEGDHYVLNGSKIFITNGGVAETFIIFAMTDKSKGTKG
ISAFIVEKSFPGFSIGKLENKMGIRASSTTELVMENCIVPKENLLSQEGKGFGIAMKTLD
GGRIGIAAKALGIAEGAFEEAVNYMKERKQFGKPLSAFQGLQWYIAEMDVKIQAAKYLVY
LAATKKQAGEPYSVDAARAKLFAAEVAMEVTTKAVQIFGGYGYTKEYPVERMMRDAKICE
IYEGTSEVQKMVIAGSILR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaagttaactagagaacaagaattagtacaacaaatggttagagaattcgca
gtaaatgaagttaaaccaatagctgctgaaatcgatgagacagaaagattccctatggaa
aatgttgaaataatggctaagttaggaatgatgggtatcccattttctaaagaatttggt
ggagcaggcggagatgtactttcatatataatcgctgtagaagaattatcaaaagtttgt
ggtactactggagttatactttcagctcatacatcattatgtgcatcagtaattaacgaa
aatggtactaaagaacaaagagaaaaatatttacctgatctttgtagcggtaagaaaatt
ggtgctttcggattaactgaaccaggtgctggtacagatgctgcaggacaacaaacaact
gctgtattagaaggtgaccattatgtattaaatggttcaaaaatattcataacaaatggt
ggagttgctgaaactttcataatctttgctatgacagataaatcaaaaggaactaaagga
atttctgcatttatagtagaaaaatcattcccaggcttctcaataggaaaattagaaaat
aagatgggtatcagagcatcttcaaccactgaattagttatggaaaactgtatagttcca
aaagaaaacctattaagtcaagaaggtaagggatttggaatagcaatgaagactcttgat
ggaggaagaattggtatagctgcaaaagcgttaggtattgcagaaggagcttttgaagaa
gctgttaattacatgaaagaaagaaagcaatttggtaagccattatcagcattccaagga
ttacaatggtatattgcagaaatggatgttaaaattcaagctgctaaatatttagtatac
ctagcagcaacaaagaagcaagctggtgagccttactcagtagatgctgcaagagctaaa
ttgtttgctgcggaagttgcgatggaagttacaactaaagcagtacaaatctttggaggg
tatggatatactaaggaatatccagtagaaagaatgatgagagatgctaagatatgcgaa
atctatgaaggaacttcagaagttcaaaagatggttatcgctggaagcattttaagatag

DBGET integrated database retrieval system