KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c22070Help
Entry
Cspa_c22070       CDS       T02467                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Cspa_c22070
Enzymes [BR:csr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Cspa_c22070
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Cspa_c22070
    1.1.1.-  
     Cspa_c22070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ApbA 2-Hacid_dh_C PALP NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AGF55972
UniProt: M1MWX5
Position
2418622..2419707
Genome map
AA seq 361 aa AA seqDB search
MKAALWYEKKDVRVEEIEEPKIITSDGVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHPL
SGTTAPVVLGHEFSGEVVEIGNNVTNFKAGDRVIVEPIVACGKCPACLEGKYNLCSSLGF
HGLCGSGGGLAEYTVFPEKFVHKIPDEMSYEQAALVEPMAVALHSIRIGKFQTGDTALVL
GSGPIGLATIECLKAAGAKLVIVLQRKSIRQEYAKRAGADVVLDPNEVNIVEEVKKLTNG
LGVDVAFETTGAQVGLDIGIESIKFEGTLVITSIWEGDAKINPNSLVFSEKKIIGTLAYR
HEFPATIAQMKDGRIKAEGYVTKKIHLDDIVEEGFGALTGPEKKKHVKILVTPDKELLTN
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcattatggtatgaaaagaaagatgttagagttgaagaaatcgaagaacca
aaaataataacaagtgatggtgtaaagatcaaagtaaaatggtgtggtatatgcggttca
gatttgcatgaatatttaggaggacctatatttataccagtaggacagccacatccatta
agtggaacaactgctccagttgttttaggacatgagttttcaggagaagttgtagagatt
ggtaataatgtaacgaattttaaagctggagatagagtaatagtagaaccaatagttgca
tgtggaaaatgtccagcatgtcttgaaggaaaatataatttatgttcatctttaggcttt
catggactttgtggaagtggaggaggattagctgaatatacagttttcccagagaaattt
gtacataaaataccagatgaaatgtcttatgaacaggcagctttagttgaaccaatggct
gtggcattacattcaattagaattggtaaatttcaaacaggggatactgcattagtttta
ggctcaggaccaatagggcttgcaactatagaatgcttaaaagcagcaggtgcaaaatta
gtaatagtattgcaaagaaaatcaataagacaagaatatgctaaaagagcaggtgcagat
gtagtattagatcctaatgaagtgaatatagtagaggaagttaaaaagcttacaaatgga
ttaggggttgatgtagcttttgaaactacaggagctcaagttggtttagatataggaatt
gaaagtataaaattcgaaggaaccttagtaataacaagtatatgggaaggtgatgctaaa
attaatcctaattcattagtattttctgaaaagaagattattggaactttagcatataga
catgaattcccagcaactattgctcaaatgaaggatggaagaataaaggcagaagggtat
gtgacaaagaaaatacatttagatgatatagttgaagaaggctttggagcactaacaggt
ccagaaaaaaagaaacatgttaagattttagtaacaccagataaagaacttttaacaaat
aactaa

DBGET integrated database retrieval system