KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c50320Help
Entry
Cspa_c50320       CDS       T02467                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00071  Fatty acid degradation
csr00072  Synthesis and degradation of ketone bodies
csr00280  Valine, leucine and isoleucine degradation
csr00310  Lysine degradation
csr00362  Benzoate degradation
csr00380  Tryptophan metabolism
csr00620  Pyruvate metabolism
csr00630  Glyoxylate and dicarboxylate metabolism
csr00640  Propanoate metabolism
csr00650  Butanoate metabolism
csr00900  Terpenoid backbone biosynthesis
csr01100  Metabolic pathways
csr01110  Biosynthesis of secondary metabolites
csr01120  Microbial metabolism in diverse environments
csr01130  Biosynthesis of antibiotics
csr01200  Carbon metabolism
csr01212  Fatty acid metabolism
csr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cspa_c50320
   00630 Glyoxylate and dicarboxylate metabolism
    Cspa_c50320
   00640 Propanoate metabolism
    Cspa_c50320
   00650 Butanoate metabolism
    Cspa_c50320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cspa_c50320
   00072 Synthesis and degradation of ketone bodies
    Cspa_c50320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cspa_c50320
   00310 Lysine degradation
    Cspa_c50320
   00380 Tryptophan metabolism
    Cspa_c50320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cspa_c50320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cspa_c50320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cspa_c50320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csr04147]
    Cspa_c50320
Enzymes [BR:csr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Cspa_c50320
Exosome [BR:csr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cspa_c50320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGF58785
UniProt: M1LZT2
Position
complement(5555998..5557134)
Genome map
AA seq 378 aa AA seqDB search
MESVYILGGLRSHIGIKNGVFKNILPEKLGAEVLKELIFKYNLHNIDEIICGNAVGTGGN
IARLMSLYAGVSEEVPAYTVDMQCGSGSMSIDMAFAKIRSGMCDLIIAGGFESSSLQPLR
YYNKNDPRYSDEKPYFQVAQFSPYEDQENVMLMGAERVAQKYNMKKEELDFWVLESHKRA
AKARNKRILNDIICSIGESDYDEGIRNRINQRLIDRLKPLVSENGFITAANSSLTNDGAA
FVILCSERYIKNNKITQKAQIVQTALKGANPLYSPESSIIVTDELLKSRKMKYSDISAFE
FNEAFAVIDVMFQRKNPTLIDRYNTLGGALAYGHPYSASGAIIMLHLLKSLEYVDGEYGI
TTVAAAGGIGSSILIKRS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagtgtatatattttaggtggacttagaagtcatataggaattaaaaatggcgtt
tttaaaaatatattaccagaaaaattaggagcagaagttttaaaagagttaatttttaaa
tataaccttcataatattgatgaaataatatgtggaaatgcagtaggtacaggaggaaat
attgctagactgatgagtttatatgcaggagtttcagaggaagttccagcatatactgtt
gatatgcaatgtggatctggaagtatgagtatagacatggcatttgctaaaataagaagt
ggtatgtgtgatttaattattgcaggtggatttgaaagtagttcattacaaccattaaga
tattataataaaaatgatccacgatatagtgatgaaaaaccatattttcaagtagcacag
ttttcaccttatgaagatcaagaaaatgtgatgttaatgggagcagaaagagttgcacaa
aagtacaatatgaaaaaggaagaacttgatttttgggttttagaaagtcataaaagagca
gctaaggcaagaaataaaagaattctaaatgacattatttgttctataggtgaaagtgat
tatgatgaaggtataagaaataggattaaccaaagacttattgacagattaaaacctcta
gtaagtgaaaatggatttattactgcagcaaattccagtttgactaatgatggtgcagca
tttgtaattttatgttcagaaagatacataaaaaataataaaataacgcagaaagcacaa
atagtacaaactgcattaaagggagccaatcctttatatagtccagaaagttcaataata
gtgacagatgaattgctaaaatcacgaaaaatgaagtatagtgatatttcagcatttgaa
tttaatgaagcctttgctgttattgatgtcatgtttcaaagaaaaaatcctacattaata
gatagatataatactttaggaggagctttagcatacggccatccatatagcgcatctgga
gcaataataatgctacatcttctaaaaagtttagaatatgtagatggagaatatggaatt
acaacagtagcagcagcgggtggaataggatcttcaatattaattaaaaggagctaa

DBGET integrated database retrieval system