KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c52990Help
Entry
Cspa_c52990       CDS       T02467                                 

Definition
(GenBank) polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00130  Ubiquinone and other terpenoid-quinone biosynthesis
csr00627  Aminobenzoate degradation
csr01100  Metabolic pathways
csr01110  Biosynthesis of secondary metabolites
csr01120  Microbial metabolism in diverse environments
csr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Cspa_c52990
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cspa_c52990
Enzymes [BR:csr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Cspa_c52990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein HpuA
Motif
Other DBs
NCBI-ProteinID: AGF59044
UniProt: M1MM91
Position
complement(5877432..5877989)
Genome map
AA seq 185 aa AA seqDB search
MELVVGITGATGIIYGVKLLEALKQIENVNTHLIMSEWAIKNLEIETDYSLDYLQELSDF
IYDSRNLGAKISSGSFITDGMIILPCSMKTLSSIANGYDDNLISRTAGVMLKEGRKLILC
PRETPLSSIHLENMLKLSRLGVRIMPPMPAFYNNPKTIEDIVNHHVTKVFDQFGIQCYTA
KRWNG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtagttgggattacaggtgcaacaggaataatttatggggttaagctcctt
gaagcattgaaacaaatagaaaatgtaaatactcatctcattatgagtgaatgggctata
aaaaatttggaaatagaaacagattattcattagattatttacaagaattatcagatttt
atttatgatagcagaaatcttggagcaaagatttctagtggatcatttattacggatgga
atgataattttgccttgtagcatgaagacacttagttcaatagctaatggatatgatgat
aatttaatttcaagaactgctggagtaatgttgaaagaaggaagaaaattaattttatgt
ccaagagaaactccattaagttcaatacatttggaaaatatgcttaaactatcaagactt
ggagttagaataatgccaccaatgccagcattttataataatcctaaaactatagaggat
attgtaaatcatcatgtgacaaaagtttttgatcaatttgggatacagtgttataccgca
aaaagatggaatggctaa

DBGET integrated database retrieval system