KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c01240Help
Entry
Cst_c01240        CDS       T02440                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00900  Terpenoid backbone biosynthesis
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
css01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cst_c01240 (ispE)
Enzymes [BR:css01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cst_c01240 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AGC67154
UniProt: L7VKH2
Position
132103..133062
Genome map
AA seq 319 aa AA seqDB search
MERIKLFAQAKINLSLDVTGRLENGYHTLRMIMQTISLCDEVVLEKAREGIEILCDHPNL
PCDERNICYKAAREFFMKTGIGAFGDGKNSDGTVSAKGCICEETGNLYAGVRINIKKRIP
IGAGLAGGSSDAAAVLKGLNILYNTNLHPGELAEIGLKCGADVPFCIYGGTYLAEGIGER
LTKLPSFSGVNAVVVKPDFSVSTAWVYKNYSLDELKERPDTDAIIDAIGTKDIAKVAGKM
RNVLESVTAVKYPEINKIKHALKKLGALGSMMSGSGPAVFGLFENFEKANTAFEELRKIY
KQTYLVSTTDGGEIYGENI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaggataaaattatttgcccaggcaaaaattaatttatcgctggatgttacagga
aggcttgaaaacggttatcatacattacgaatgattatgcagacaatatccctgtgcgac
gaagtagtgcttgaaaaggcacgggaggggattgaaatactgtgtgatcatccaaacctt
ccgtgtgacgaaagaaatatctgttacaaagctgcaagagaattctttatgaaaacgggt
attggagcctttggtgacggcaaaaattctgatggaacagtttcggccaaggggtgcatc
tgtgaggaaacaggtaacctgtatgccggggtaagaataaatataaagaaaagaattccg
atcggtgccgggcttgcgggcggaagcagcgacgccgcagcggtgctaaaaggtctgaat
attctgtataacacaaatctgcaccctggcgaacttgccgaaataggccttaaatgcggt
gccgacgtaccgttttgcatatacggcggcacatacctggcagagggaattggggaaagg
cttacgaaactgccgtcgttcagcggcgtgaatgcagtggtggtaaagcctgatttttcg
gtatccaccgcatgggtgtataaaaactacagtttggacgaacttaaggaacgcccggat
accgatgccattattgatgcaataggaacgaaggatattgcaaaggttgccggtaaaatg
cgtaatgtacttgaaagtgttacagcggtgaaatatccggagataaacaaaatcaaacat
gccctgaaaaaactcggggccctgggcagtatgatgagcggaagcggccctgcggtattc
ggattgtttgaaaatttcgaaaaagccaatactgcgtttgaagagctcagaaaaatttat
aaacagacatatctggtttccacaacagacggaggagaaatctatggcgaaaatatctaa

DBGET integrated database retrieval system