KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c03130Help
Entry
Cst_c03130        CDS       T02440                                 

Gene name
bglZ
Definition
(GenBank) beta-glucosidase BglZ
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00460  Cyanoamino acid metabolism
css00500  Starch and sucrose metabolism
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:css00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cst_c03130 (bglZ)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Cst_c03130 (bglZ)
Enzymes [BR:css01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Cst_c03130 (bglZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like CARDB Top6b_C
Motif
Other DBs
NCBI-ProteinID: AGC67337
UniProt: L7VKQ9
Position
343402..345786
Genome map
AA seq 794 aa AA seqDB search
MVIPIVARVSEKVIIYYAGTVYENLNDKGITGVIKMQRDIKKIISQMTLEEKASLCSGLD
AWNLKSVERLGIPSIMVSDGPHGLRKETTDPTDPGKKTTVPATCFPTAVGLASSWNRELV
EKVGAALGEECQAEGIAVLLGPGTNIKRSPLCGRNFEYFSEDPYLSSEMAASHIKGVQSR
GVGTSLKHFAANNQEHRRMSVDAVIDERTLREIYLASFEGAVKKAKPWTIMCSYNRVNGE
YASENKFLLTDVLRNEWGFEGIVVSDWGAVNERVKGLEAGLDLEMPSSFGIGDQKIVEAV
KKGELPEEVLDRTVERILNLIFKAVDNRKENAGYDREAHHKLAREAARECMVLLKNEDKI
LPLRKQGTIAVIGEFAKRPRYQGGGSSHVNPTIMDSPYEEIKKSAGNNADVIYAQGYFIE
KDEPDEKLLEEAKQAALKADVAVIFAGLPEHYECEGYDRQHMRMPESHCTLIEEVAKVQP
NVVVVLCNGSPVEMPWIDKVKGLLEAYLGGQAMGGAIADLLFGDANPSGKLAETFPKQLS
DNPSYLNFPGEGDRVEYREGIFVGYRYYDKKNMEPLFPFGYGLSYTTFEYGDLKISRKEI
SDNETVTVSVKVKNTGDMAGKEIVQLYVRDIESSVIRPEKELKGFEKVELKPGEEKTVVF
ELDKRAFAYYNTGIRDWHVETGEFEILIGRSSRDIVLKDKIFVKSTVTIKKPVDRNTLVG
DLLSDRVLEPVFREFIINEIKNRYLLDLLENEDKSLLSVWMRYTPLRSLANSTGGELNEE
KLNRLIDTLNANIK
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
gtggtaataccaattgttgcaagagtgtctgagaaagttataatttattatgccggaacg
gtttacgaaaatttgaacgataaaggcataacaggagtgataaaaatgcaaagggacatc
aaaaaaattatttcacaaatgacgctggaagaaaaggcgagcttatgctcgggccttgac
gcctggaaccttaaaagcgtagaacgtttgggcattccgtccattatggtatctgacggc
ccccatggtctcagaaaagagacaacggatcccactgatcccggtaagaaaaccactgtc
ccggccacatgtttccccactgcggttggccttgcaagctcatggaaccgtgaactggtg
gagaaagtaggcgccgcattgggggaagaatgccaggctgaaggaatagcagtgcttctt
gggccgggaaccaatataaaacgttcccctctttgcggaagaaactttgaatatttttcg
gaagacccgtacctttcttcggagatggcagcaagccatataaaaggagtgcagagccgg
ggagtggggacgtccctgaagcattttgcggcaaataaccaggaacaccgcagaatgagc
gtggatgcggtaattgacgaaagaacgctgcgtgaaatttacctcgccagtttcgaaggg
gcggttaaaaaggcgaagccgtggacgatcatgtgttcatacaacagggtaaacggcgag
tatgcatctgaaaataaatttctgttaacagatgtactgagaaatgaatggggttttgaa
ggcattgtggtatccgactggggagcggtgaatgagagggtaaagggactggaagccgga
cttgatcttgaaatgccgtcaagcttcggtattggagaccaaaaaatagttgaagccgta
aagaagggtgagctgcccgaagaggtattggacagaaccgttgaaaggatacttaattta
atttttaaagcggtggataacaggaaagaaaatgccggatatgaccgggaagctcatcac
aaactggccagagaagcggcaagggagtgcatggtgctgcttaagaacgaggacaaaata
cttccgcttaggaagcagggaaccatagccgtaataggcgaatttgctaaaagaccacgg
tatcagggcggaggaagctcccatgtaaatcccacaatcatggatagtccatatgaagaa
atcaaaaaatcagcgggaaacaatgcagatgttatatatgcgcaaggttattttattgaa
aaggacgagccagatgaaaaactcctggaggaagcaaagcaggcggcgctgaaggcagat
gtcgccgtgatatttgcagggcttcccgagcattatgaatgcgagggctatgaccgtcag
catatgagaatgcccgaaagccactgcacgcttatcgaagaagtggcgaaagtacaaccc
aatgtggtggtggtattatgcaacggttcaccggtggagatgccgtggattgacaaagtg
aagggattgctggaggcttacctgggcggacaagccatgggcggagccattgccgatctt
ctgttcggagacgccaatcccagcgggaagctcgccgagactttcccgaaacagttaagc
gataacccttcatatttgaattttcccggggaaggggacagggttgaatacagggaaggc
atattcgtgggctacaggtattatgacaaaaagaatatggaaccgctgttcccgttcgga
tacgggctcagctacactacgtttgagtacggcgatctgaaaataagcaggaaagaaata
tctgataacgaaacggtgactgtgagcgtaaaggttaagaataccggagatatggcgggt
aaggagattgtgcagctttacgtaagggatattgaaagctcggtaataagaccggagaag
gaactgaagggttttgaaaaagttgaacttaagcccggcgaggaaaaaacggtggtgttt
gaacttgacaagagggcgtttgcttattacaacaccggtataagggactggcatgttgaa
accggtgaatttgagattttaataggcagatcctcaagggacatagtgcttaaagacaag
atattcgtcaaatcaaccgttaccataaaaaaaccggtggacagaaacacgctggtgggg
gatttgctttctgatcgggttcttgagcctgtattcagagagtttattattaacgagata
aaaaacaggtacttgttggatttactggagaacgaggataaatccctcctgagtgtgtgg
atgaggtatactcctctgcgttcattggcgaacagtacgggtggggaactgaacgaggaa
aagctgaacaggctgattgatacactgaatgcaaatattaaataa

DBGET integrated database retrieval system