KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c03720Help
Entry
Cst_c03720        CDS       T02440                                 

Gene name
murA1
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00520  Amino sugar and nucleotide sugar metabolism
css00550  Peptidoglycan biosynthesis
css01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cst_c03720 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cst_c03720 (murA1)
Enzymes [BR:css01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cst_c03720 (murA1)
Peptidoglycan biosynthesis and degradation proteins [BR:css01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Cst_c03720 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AGC67396
UniProt: L7VLL8
Position
410326..411582
Genome map
AA seq 418 aa AA seqDB search
MSVFLIDGGIPLKGTVRISGAKNAILPALAACLLTDGKTVLKDVPNLEDVHTMCNLLASL
GARVNFNVEKREITIETTSVIEDTAPYELVNTMRASFLVMGPLLARKGRARVPLPGGCAI
GSRPVDLHLKGFSALGATITTGHGYVEARVNGRLTGARIYLDFPSVGATENILMAAVLAK
GQTVIENAASEPEIVDLATMLVSMGANVTGAGTDTIRVIGTDKLHPTEHMVIPDRIEAGT
YMLAAAMTGGEVNIENTMADHLKPVIAKLREAGVEITEEFNRINVRAVRRPKAVDVKTHP
YPGFPTDMQAQMTAFLSQAEGTSMVVETIFENRFMHINELKRMGARIKIDGRTAIIEGGV
QLMGAQVRATDLRAGAALVLAGLCAKDRTEISEIHHVDRGYEAMEQKLRALGARIVRV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttttttaattgacggtggtataccccttaaaggtacggttcggataagcgga
gcgaagaatgccatacttccggctttggcggcatgcctgttaacagatggtaaaactgta
ttgaaggatgtcccgaaccttgaagacgtacatacgatgtgtaatcttttggcatctttg
ggggccagggtcaattttaacgttgaaaaaagggaaataaccatcgaaaccacgtcggtt
attgaagatacagcaccctacgagcttgtcaatacaatgcgtgcttcgtttcttgttatg
ggcccgctgctggcacgaaaaggccgcgcgagggtacctcttccgggtggatgcgccata
ggaagcaggcctgttgatctgcacttgaaaggtttttcagcgcttggcgcaaccattacc
acaggccatggttatgtggaagcccgtgttaacggaaggcttacaggcgcaagaatttat
cttgactttccaagcgttggggcgactgaaaacatacttatggcggcggttcttgcaaaa
ggccagacggtgatagaaaacgcggccagcgagcctgaaattgtggatcttgcgacaatg
ctggtttcaatgggagcaaatgtaaccggagcaggaaccgatacaatacgcgtaataggg
actgataaactgcaccccaccgaacacatggtcattcccgacagaattgaagcgggcaca
tatatgcttgctgccgcaatgaccggcggtgaggttaacattgaaaacacaatggccgat
catctgaaaccggttatcgctaagctgcgcgaggcaggcgtcgagataaccgaggaattt
aacagaataaatgtgagagctgtcaggcgtcccaaagcagtggacgtcaaaactcatccg
tatcccggtttccctaccgatatgcaggctcagatgacggcttttttaagccaggctgaa
gggacaagtatggttgttgaaaccatttttgaaaaccgttttatgcacataaatgagcta
aaaagaatgggcgcgagaataaaaatagacggcagaacggcaataatcgaaggcggagtc
cagctgatgggtgctcaggtacgggccaccgatctgagagccggagcggcgctggtactt
gccggattatgtgcaaaggacagaaccgaaataagtgaaattcatcatgtcgatcgtggc
tacgaggcgatggaacagaaattgagagcgctcggggcgaggattgtaagggtgtga

DBGET integrated database retrieval system