KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c11010Help
Entry
Cst_c11010        CDS       T02440                                 

Gene name
pycB
Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00620  Pyruvate metabolism
css01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:css00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cst_c11010 (pycB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:css02000]
    Cst_c11010 (pycB)
Enzymes [BR:css01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Cst_c11010 (pycB)
Transporters [BR:css02000]
 Other transporters
  Primary active transporters [TC:3]
   Cst_c11010 (pycB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like MPLKIP TGT
Motif
Other DBs
NCBI-ProteinID: AGC68097
UniProt: L7VMY5
Position
1192680..1194074
Genome map
AA seq 464 aa AA seqDB search
MGIKITETVLRDAHQSLIATRMKTEDMLPIIEKMDKVGYHSLECWGGATFDACLRFLNED
PWERLRKIRDKAKNTKLQMLLRGQNLLGYKHYADDVVEYFVQKAVANGIDIIRIFDALND
PRNVEVAIKATKKEGGHAQAAVCYTISPFHSLEQFVKDAKKLVEMGADSICIKDMAGLLT
PYNAYELVKALKENVKVPIQLHTHYTSGVASMTYLKAIEAGCDVVDCAISPMSMGTSQPP
TEAIVATLQGTPYDTGYDLKLLSEIADYFRPLREKYLKSGLLDTKVLGVDINTLLYQVPG
GMLSNLVSQLKQFGKEDKFEEVLAEVPRVREDLGYPPLVTPTSQIVGTQAVMNVISGERY
KMVPKETKALVKGEYGKTPAPIKEEIIKKIIGDEKRITCRPADLLEPELDKIRDEMKEYL
EQDEDVLTYALFPQVAKKFFEYRKAAKYKIDPDMVNYEERVHPV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaaaataactgaaaccgttctcagggacgcgcaccagtcgttgatagccacg
agaatgaaaactgaagacatgcttccgataattgaaaaaatggacaaagtgggttatcat
tctttggaatgctggggcggcgcaacctttgatgcgtgtcttcgtttcctgaatgaggat
ccctgggagaggctcagaaaaataagagacaaggcaaagaacacaaaactccagatgctt
ctgcgcgggcagaatcttctgggatataaacactacgccgacgacgtggttgaatatttc
gttcagaaagcggttgccaacggtattgatattatccgcatatttgatgcattaaacgac
ccgagaaacgttgaagtggcaataaaggcaaccaagaaggaaggcggccatgcacaggcg
gctgtgtgctatactataagtccttttcacagtcttgaacagtttgtaaaggacgcaaag
aagttggttgaaatgggtgccgactcaatatgtattaaggatatggccggacttttgacg
ccatacaatgcttatgagcttgtaaaagccctgaaggaaaacgtaaaggtcccgattcag
ctgcatacccactataccagcggagttgcttcaatgacatacctgaaagccattgaggca
ggatgtgatgtggtagactgcgccatttcgccgatgtcaatgggaacaagccagccaccc
accgaagcaattgtggcaacgctgcagggaacgccttatgataccgggtatgatttgaaa
ttgctgtcggagattgccgattatttccgtccgctgagggaaaagtatctaaaatcgggg
ctgctggataccaaggttctcggtgtggatatcaacacgctgctgtatcaggtacccggt
ggtatgctttcgaaccttgtttcgcagctcaaacagttcggcaaggaggacaaatttgaa
gaagttcttgcggaagtgccgagggtacgcgaagatttgggatatccgccgctggttaca
cccacaagccagattgtcggaactcaggccgttatgaatgttatttcaggcgaacgttac
aagatggttccgaaagaaaccaaagcgcttgttaagggcgaatatgggaaaacccctgca
ccgataaaggaagaaatcattaaaaagattataggcgatgaaaagaggattacatgccgt
cctgccgatctgctcgagcccgaactggataagatcagggacgaaatgaaagagtacctt
gaacaggatgaagacgtgctgacctatgcactgttcccgcaggttgcaaagaaattcttt
gaatacagaaaggctgcaaaatataagatagatcccgacatggtgaattatgaggaaaga
gttcatccggtttaa

DBGET integrated database retrieval system