KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c14170Help
Entry
Cst_c14170        CDS       T02440                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00260  Glycine, serine and threonine metabolism
css00750  Vitamin B6 metabolism
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
css01120  Microbial metabolism in diverse environments
css01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cst_c14170 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cst_c14170 (thrC)
Enzymes [BR:css01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cst_c14170 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF1995
Motif
Other DBs
NCBI-ProteinID: AGC68408
UniProt: L7VS49
Position
complement(1531149..1532642)
Genome map
AA seq 497 aa AA seqDB search
MRYRSTRGGFSGVTSSEAIKMGIAPDGGLFVPEDDVTVDLKFIENLVSDNYRQRAEKILS
FFLTDFDRAELEECVKKAYGNNFSSPEVTPLVHLHEHLHMLELWHGPTCAFKDMALQILP
HFMVKAIKKTGENSKIVILTATSGDTGKAALEGFADVDGTYIIVFYPNGGVSEIQRLQMV
TQTGKNTNVIAVNGNFDDTQSGVKKIFNDKNICDKIQDKGFRFSSANSINWGRLVPQIVY
YFSAYADLLKDKIIEPGEKINFVVPTGNFGNILAAWYAMKMGLPVNRLICASNENNILTD
FIITGTYDRRREFHKTLSPSMDILISSNLERLLFELGGKDAGLIRGYMNDLNEKGYYTVN
KTIKGKIQEIFWGGYSSDNETLACIRSVYKDYGYVLDTHTAVAMDVYDKYVIYSGDLTQT
VIVSTASPFKFSGSVAKALFGDETEGLDEFGLLRLLSEKTGWEIPKGLKDLDRKEILHKT
VCEKDEMGDVVLNILNS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacagaagcacacgcggtggattttccggcgttacttcttcggaagcaattaaa
atgggtattgcgcctgacggcgggctgtttgttccggaagatgacgtaactgttgattta
aagtttattgaaaatttggttagtgataattaccggcaaagagcagaaaaaatactttct
ttttttctgaccgattttgacagggcagaattggaagaatgcgtaaagaaagcctatggg
aataatttttcatctcccgaggttactcctcttgtacatctgcacgagcatcttcatatg
cttgagctctggcacggccctacctgtgcttttaaggatatggctttgcaaatacttccg
cactttatggtaaaagccatcaagaaaacaggagaaaattcaaaaatagttatacttacg
gctacatccggtgatacaggcaaggctgcacttgaaggatttgcagacgtcgacggcacg
tatatcattgtattctatccaaacggcggagtaagtgaaatccagagacttcagatggtt
actcagacaggcaaaaatacgaatgttatagccgtaaacgggaatttcgacgatactcag
agcggcgtaaaaaagattttcaatgacaaaaacatatgtgataagatacaggacaaaggt
ttcaggttttcatcggcgaactcgataaactggggaagactggttccgcagattgtatat
tatttttccgcatatgcggatttattgaaggataaaatcattgaacccggagagaagata
aattttgtggttccgacaggtaatttcgggaatattcttgcggcatggtatgcgatgaaa
atggggctgcctgtgaacaggcttatatgtgcatcaaatgaaaataatatacttaccgac
tttattattacaggaacatatgacaggagaagggaattccataaaactctgtctccgtca
atggatatacttatttccagtaatcttgaaaggctgctttttgaactcggaggaaaagat
gccgggcttatacgcggttatatgaacgacctcaacgaaaagggttattatacggtgaac
aaaacaattaagggaaaaattcaggaaatattctggggaggatattcgagtgataatgaa
accctcgcctgcataagaagcgtttacaaggattatggttatgtattggatactcacact
gcagtggcgatggacgtttatgacaagtatgtaatatatagcggagatcttactcagacc
gtaatcgtttccaccgcaagcccgttcaagttcagcggcagcgtagcaaaggctctgttc
ggtgacgaaaccgaagggcttgacgagttcggacttctgaggctgctttcggaaaaaacc
ggctgggagataccaaaaggattaaaagatctggacaggaaagaaatacttcacaaaacg
gtctgcgaaaaggatgaaatgggtgacgtagttcttaatatccttaattcgtaa

DBGET integrated database retrieval system