KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c16450Help
Entry
Cst_c16450        CDS       T02440                                 

Gene name
agaR3
Definition
(GenBank) alpha-galactosidase 1
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00052  Galactose metabolism
css00561  Glycerolipid metabolism
css00600  Sphingolipid metabolism
css01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cst_c16450 (agaR3)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cst_c16450 (agaR3)
   00600 Sphingolipid metabolism
    Cst_c16450 (agaR3)
Enzymes [BR:css01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cst_c16450 (agaR3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 GHL10
Motif
Other DBs
NCBI-ProteinID: AGC68629
UniProt: L7VPP0
Position
complement(1778920..1781130)
Genome map
AA seq 736 aa AA seqDB search
MPIIFHEESGEFHLYNKSISYIIKILPNKQLGNLYFGKVIKDRKSFSHLFQKKARPLSAY
VFEDDPAFSLQHTMQEYPSYGTTDFRSPAFEIKQKNGSRISCFEYKKHEIFAGKNGLEGL
PATYVEEPADADTLEITLYDELIKTELVLSYTIFNNYSAIARSARFINKGEETIVLERAM
SASIDFIDSDFEMIQLSGAWSRERHIKTRKLQQGIQGVYSMRGISSAEHNPFIALKRPNT
DENSGEVYGFSLIYSGNHLEQVEVDTHNMTRVMLGIHPDTFEWPLEKGEFFQTPEAIIVY
SDEGLNKMSQTFHKLFSKHLISRQWRDKPRPVLINSWEATGANFTEEKLLRMAEIAKELG
IELFVLDDGWFGNRDNDKAGLGDWNIVNRKKLPDGIEGLADKIESMGMKFGLWFEPESVN
KDSNLYRKHPDWIIATPGRRTSASRNQYVLDFSRKEVVDYIYSVMEKVLSSAKISYVKWD
MNRYITECYSLGAEAGSQGTVFHRYILGVYNLFSRLTERFPYILFEACSSGGARFDPGIL
YYAPQVWTSDNTDAIERLKIQYGTSLLYPISTMGAHVSEVPNQQVGRITPIETRANVAYF
GVFGYELDLTLLTEEEKEKIKKQITFYKFHRELFLKGTFYRILSPFDGNETSWIVVSEDK
SEAIAAYYKTLNYANKGWKRLKLVGLDRDKKYIIDNDNERYYYGDELMNVGIVLKDEELC
ANGNDFSSIIFYLKSI
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgccaattatttttcatgaagaatctggtgaatttcatctttataataaaagcatcagc
tatataattaaaatattgcctaataaacagcttggaaacctttatttcggcaaagttata
aaagacagaaagtcattttcacatttattccagaaaaaagccagacccttatcggcttat
gtttttgaagatgatccggctttttcacttcagcataccatgcaagaatatccgtcatat
gggactactgattttagaagccctgcttttgagataaagcagaaaaatgggagcagaata
tcctgttttgaatataaaaaacatgaaatttttgcaggcaagaatggcttagaaggcctt
ccggcgacttatgtggaagaaccagccgatgcagatacccttgaaataacgctgtatgat
gaacttattaaaacagaactggttttgagctatacaatattcaacaattattctgcgata
gccagaagcgcaaggttcataaacaaaggagaagaaacgattgtgctggaaagggcaatg
agcgcaagcattgattttattgacagcgattttgagatgatccagctttccggcgcatgg
tcacgggaacggcatattaaaacgagaaaacttcagcagggcatacagggggtttacagt
atgcgcggtattagcagtgcggaacataatccgtttattgccctaaaaagaccaaatacg
gatgaaaacagcggcgaagtatatggtttcagcttaatatacagcggcaaccatcttgaa
caggttgaggtagatacccacaacatgacaagagttatgctgggtattcatccggatact
tttgagtggccgttggaaaaaggagaattttttcagacacctgaagcaataattgtttat
tcagacgaggggctcaataagatgagtcagacattccataagctgttcagcaaacatctt
ataagcagacaatggcgtgacaaacccagaccggttcttataaacagttgggaagctact
ggcgcaaattttactgaggaaaagcttttaagaatggcagaaatagcaaaggaacttgga
atcgaactgtttgtgcttgatgacggatggtttggaaaccgagacaacgataaagcaggg
ctgggagattggaatattgttaacaggaaaaaacttcccgatggtattgaaggcctggct
gacaaaattgaatcaatgggcatgaaattcgggctttggtttgagccggaatcagtaaat
aaggacagcaacttatacagaaaacaccctgattggataattgcgaccccgggaagaagg
acatcagcttcacgtaaccagtacgttttggatttctcgagaaaagaagtggttgattat
atttattccgtaatggaaaaagttctgagcagtgcaaaaatatcctatgtaaaatgggat
atgaacaggtatataactgagtgttattctttgggggcggaagccggcagccaaggaacg
gtttttcaccggtatattctgggagtatataatttattttcaagattgacagagaggttt
ccatatatactttttgaagcatgctcaagcggtggggcacggtttgatcccggaatactg
tattatgctccgcaagtatggacaagcgataatactgatgcaattgagagactgaagatt
cagtatggtacttctctgctctatccaataagtactatgggagctcatgtttcagaagtt
cccaatcagcaagtaggaagaattacgcctattgaaacaagagccaatgtagcttatttc
ggagtgtttggttatgaacttgatttgactttattaacagaagaagaaaaagaaaagata
aaaaaacagattactttttataaattccacagagaactttttcttaaaggaacattttac
cgtatattaagcccgtttgacggaaatgaaacgtcctggatagttgtatcagaagataaa
tcagaagctattgcagcgtattacaagactctgaattatgctaacaaaggctggaaaagg
cttaaacttgtagggcttgacagagataagaaatatattattgacaacgacaatgaaagg
tattattacggtgatgaacttatgaatgtcggtattgtattaaaggatgaagaattatgt
gcaaacggaaatgacttttcgtccattatcttttatttgaaaagtatctaa

DBGET integrated database retrieval system