KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c20160Help
Entry
Cst_c20160        CDS       T02440                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00400  Phenylalanine, tyrosine and tryptophan biosynthesis
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
css01130  Biosynthesis of antibiotics
css01230  Biosynthesis of amino acids
Module
css_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cst_c20160 (trpC)
Enzymes [BR:css01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cst_c20160 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Crinivirus_P26 His_biosynth Ku
Motif
Other DBs
NCBI-ProteinID: AGC68989
UniProt: L7VQN5
Position
complement(2191470..2192294)
Genome map
AA seq 274 aa AA seqDB search
MFLEKLVKSAEMRVETAKKRVSPDELKSRVLNTDGNKKFYRREDFAFEKSLKKEGISFIC
ELKKASPSKGILDSSFPYLEIAENYEKAGADAVSVLTEPEYFMGSDDYLKEISARINIPV
LRKDFIVDEYQIYEAKLIGADAVLLICALLDTRTIKKYIEICDILGISALVEAHTEEEIR
SALEAGARVIGVNNRDLRTFEVDIRKCIDLRKFVPENVIFVAESGIKTRDDILMLEQAKV
DAVLIGETLMRSRDKKAMLAYLKGETKQIPEELK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaagctggtaaaatcagccgaaatgcgcgttgaaaccgcaaaaaaaaga
gtatcgccggatgaactgaaatcaagggttttaaacacagatgggaataaaaagttttac
aggcgggaagatttcgcctttgagaaaagtttgaaaaaagaaggaatctcatttatttgc
gagttaaaaaaagcttcaccgtcgaagggaattttagattcttcttttccataccttgaa
atcgcggagaattatgaaaaggccggagccgatgccgtatcggttcttacggaacctgaa
tatttcatgggaagtgatgactatcttaaagaaataagtgcacgcataaacattcccgta
ctgcgcaaggactttattgttgatgagtatcagatttacgaggcaaaattaataggtgca
gatgcggtattgttaatctgtgccctgcttgatacccggacaattaaaaaatacatagaa
atatgcgatatacttggcatttcggctttggtggaagcccataccgaggaagaaataagg
tcggcacttgaagcgggcgcaagggtgattggcgtaaacaacagggatttaagaaccttt
gaagtggatatccggaaatgtattgatttaaggaagtttgttcctgaaaacgtcatattt
gtagccgaaagcgggattaaaacacgcgatgacatattgatgcttgagcaggcaaaggtt
gatgcggttctgattggggaaacgcttatgaggagcagggacaaaaaagccatgcttgca
tacctgaaaggggaaaccaaacagataccggaggagttaaaatga

DBGET integrated database retrieval system