KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c25900Help
Entry
Cst_c25900        CDS       T02440                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:css00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Cst_c25900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:css03400]
    Cst_c25900
Enzymes [BR:css01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cst_c25900
DNA repair and recombination proteins [BR:css03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cst_c25900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 PIF1 Helicase_RecD UvrD_C HHH_2 T2SSE AAA_22 ATPase_2 PhoH HHH_5 AAA_16 AAA_28 DUF2075 UvrD-helicase AAA DEAD Hjc TsaE NTPase_1 MobB NACHT AAA_24 AAA_18 AAA_33 cobW MeaB DUF815 TrwB_AAD_bind RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: AGC69540
UniProt: L7VMU1
Position
complement(2784877..2787090)
Genome map
AA seq 737 aa AA seqDB search
MERIEGIVEDIIFCNRDNWYTVCDIRSGRRLITVVGYMPDIAIGETVVVSGTWTVHQDYG
KQLKVETCERVLPTTTDAIYKYLASGIIKGIGETTAKKIVDRFGEDTLRILQFEPQRLSE
IKGISEEKALQIGQAFIEREQMRQIVMFLQKYGISATYAVKVWKKFGNEAVNEIKRNPYR
LTDEDINIGFKIADRVAISMGIDIESEFRIASGIQYALSKAVQDGHVYLPSDVLIPYASR
LLDVSAEAVERVLSGLIFEESVCIEKTPEEDRVYLSPFFKAEQCVARKLAVLSSIGPKKN
ILNLEKLLEEVQEEQRIEYTAEQLEAIRCSATESILVVTGGPGTGKTTLIRGIISIFEKS
GLEIVLAAPTGRAAKRMTEATGKEAKTIHRLLEMEFSVDESYREFRKNERDPIKADAIII
DEMSMVDILLMHSLLKAVEPGTRLILVGDVDQLPSVGPGKVLGDIIESECLKVIRLNTVF
RQAGESSIVINAHRINKGIFPEFSMSEGDFFFIPRSTPKATAQAVLELCTARIPEKFGLD
PMKDIQVLSPSKKGDAGIYNLNALLQQCLNPPESGVREKNFRGVVFRENDRVMQIKNNYN
LPWTMEDKNRKVVSGEGVFNGDMGIIREIDPENDYLTVLFDDGKIVEYSFDMLDELEHSY
AITVHKSQGSEFPAVVVALSGVPPMLRLRNLLYTAITRARQLVVIVGDIEILRQMVNNAT
ERERYTGLKERLIRYFE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
ttggagagaatagaaggaattgtggaagatattatattttgcaatagggacaactggtat
accgtatgtgatatacgctcggggagaaggcttataaccgtggtgggttatatgcccgac
attgccattggcgaaacggttgttgtaagcgggacgtggacggtacatcaggactatggg
aaacagctgaaggttgagacctgtgaaagagtgcttccgacgacgaccgatgccatatat
aagtacctcgcgtcgggtataattaagggaattggcgaaacaacggcgaaaaaaattgtt
gacaggttcggcgaggacacgttaaggattttgcagttcgaaccgcagcgcctgtccgag
ataaagggaatcagtgaagagaaggctttacagattggacaggcttttattgaaagggaa
cagatgcggcaaatcgtgatgttccttcagaaatacggaatttcagccacttatgccgta
aaagtatggaaaaagttcggaaatgaagccgttaatgaaataaaacgcaatccataccga
ctgaccgatgaggatataaatatcggatttaaaattgcggaccgtgttgcaatatcgatg
ggaattgatatcgaatccgaattcagaattgccagcggaatccagtacgcgttgtcgaaa
gcggtgcaggacgggcatgtgtatctgccgtccgatgtactgataccatatgcctcaagg
cttctggatgtgtcagccgaagcggtggaaagagtcctgtcaggccttatctttgaagaa
agcgtctgtattgaaaaaacgcccgaggaagacagggtatatctgtccccatttttcaaa
gccgagcagtgcgtggcaaggaaacttgcagttttaagcagcatagggccgaaaaagaat
atattgaatctggaaaagctgcttgaggaagtccaggaagaacagcgtattgaatacacc
gcagaacagcttgaggcaatacgctgttcggccacggaaagcatactggttgttaccggc
ggccccggaacgggtaaaaccacgcttataaggggtattatatcgatatttgaaaaaagc
ggcctggaaattgttttagcggcacctaccgggagggcggcaaaaaggatgaccgaggcc
acgggcaaagaggcaaaaaccattcaccgccttcttgagatggagttctcagtggatgaa
agctacagggaattcaggaagaatgagcgggatccgataaaggccgatgccataattata
gacgaaatgtcaatggttgacattctgcttatgcattcgttgcttaaggcggttgaaccc
ggtacaaggcttattctggtcggagacgtggaccagcttccgtcggtgggaccgggaaag
gtactgggcgacataattgaaagcgaatgccttaaagtcatacggttaaacacggttttc
aggcaggccggtgaaagttccatcgtcattaacgcccacaggataaacaaaggtatcttt
ccggaatttagtatgtccgaaggagattttttctttatcccgagaagcacgccgaaagca
acggcacaggccgtactggagctatgcacggctcggattcctgagaaattcggcctggac
ccgatgaaagacatccaggtgctgtcgccgtcgaaaaaaggtgatgcggggatttacaac
ctgaacgctctgttgcagcagtgcctgaacccgccggaatcaggagtgagggaaaaaaac
ttcaggggcgtggttttcagggaaaatgacagggtaatgcagataaagaataactacaat
ttgccatggacgatggaggacaaaaaccgaaaggttgtaagcggtgaaggcgtattcaac
ggagatatgggcataatccgggaaattgacccggaaaatgattatttgactgtcctgttt
gatgacgggaaaattgtggaatacagtttcgacatgctggatgaactggagcattcatat
gcgattaccgttcacaaaagccagggaagtgagttccccgcggtggttgtagcgctgtcg
ggcgtcccgccgatgctgcggttaagaaaccttttatacaccgcaataaccagagcgcgg
cagcttgtagtaatcgtaggcgatattgaaatactgaggcagatggttaataacgctacc
gaaagggagaggtatacagggctgaaagaaaggctgatacggtattttgaatga

DBGET integrated database retrieval system