KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c26400Help
Entry
Cst_c26400        CDS       T02440                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css03010  Ribosome
Brite
KEGG Orthology (KO) [BR:css00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Cst_c26400 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:css03011]
    Cst_c26400 (rplV)
Ribosome [BR:css03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Cst_c26400 (rplV)
  Bacteria
    Cst_c26400 (rplV)
  Archaea
    Cst_c26400 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGC69590
UniProt: L7VMZ2
Position
complement(2819837..2820298)
Genome map
AA seq 153 aa AA seqDB search
MSRDELLEKKDEILAQYRQARRKSEKLPILTKKEKKILGIGKDEGRAVLRNVRVSSRKAK
LVIDLIRNKKLDEAYAILRYTPKRAAGILEKLLKSAEANAVNNNGLNRDNLYVAEIYATQ
GPTMKRIRPRAHGRAYRINKRTSHITVVLREMA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggacgaacttctggaaaaaaaggacgaaatattggctcaataccggcaggca
cgcagaaaatctgaaaagcttccaatactcacgaaaaaagagaagaaaattctgggcatt
ggaaaggatgaaggcagagccgtattgagaaatgtcagggtgtcgtccagaaaagcaaaa
ttggttattgatttgatacgtaacaagaaacttgatgaggcttatgccattttaagatat
acaccgaagagagcggcaggaatcctggaaaaactgctgaaatctgcagaagctaatgcc
gtgaacaacaacggtctgaaccgcgacaatttatatgtggccgaaatttatgcaacccag
ggaccgactatgaagagaatcagaccgagggcacacgggcgtgcttacaggataaacaaa
agaaccagccatattactgtggtgttgagagaaatggcataa

DBGET integrated database retrieval system