KEGG   Acetoanaerobium sticklandii: CLOST_0644Help
Entry
CLOST_0644        CDS       T01334                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00010  Glycolysis / Gluconeogenesis
cst00051  Fructose and mannose metabolism
cst00562  Inositol phosphate metabolism
cst01100  Metabolic pathways
cst01110  Biosynthesis of secondary metabolites
cst01120  Microbial metabolism in diverse environments
cst01130  Biosynthesis of antibiotics
cst01200  Carbon metabolism
cst01230  Biosynthesis of amino acids
Module
cst_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cst_M00002  Glycolysis, core module involving three-carbon compounds
cst_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0644 (tpiA)
   00051 Fructose and mannose metabolism
    CLOST_0644 (tpiA)
   00562 Inositol phosphate metabolism
    CLOST_0644 (tpiA)
Enzymes [BR:cst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLOST_0644 (tpiA)
Exosome [BR:cst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLOST_0644 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLOST_0644 (tpiA)
  Exosomal proteins of melanoma cells
   CLOST_0644 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Thiamine_BP MreB_Mbl
Motif
Other DBs
NCBI-ProteinID: CBH20770
UniProt: E3PWF5
Position
763285..764031
Genome map
AA seq 248 aa AA seqDB search
MRKPIIAGNWKMHKTIAEALEFVEKIKAEVAGTDVETVICAPFTQLKDIKQAVKDTNIKV
GAQNMHYEEKGAFTGEISAAMLKELMVDYVIIGHSERRQYFNETDETVNKKVKKALAYDI
TPIMCVGESLEEREAEKTKEIVKDQTMKGLEGLTNEQVSSLVIAYEPIWAIGTGKTASSQ
DANEVIAYIREVVKDMYSEEVSEEVRIQYGGSVKPSNVEEIMNESDIDGALVGGASLEAS
DFTALVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctataatagctggaaattggaaaatgcataaaacaatagccgaggcgctt
gagtttgtagaaaaaattaaagctgaggttgctggaacggatgtagagacagttatttgc
gctccatttacacagctaaaggatataaaacaagcagtaaaggatacgaacatcaaagta
ggagctcaaaacatgcattatgaggaaaaaggagcttttactggtgaaatatcagcagct
atgctaaaagaactaatggtagattatgtaataataggacattcagagagaagacagtat
tttaatgagacagatgaaactgtcaataaaaaagtaaaaaaggctttagcttatgatata
actccaatcatgtgcgtaggagagtctttagaggaaagagaagcagaaaaaactaaagaa
atagtaaaagaccaaacgatgaaaggcctagaaggacttactaatgagcaggtctcatct
cttgtcatagcctatgagcctatttgggctataggtacaggaaaaactgcatctagccaa
gatgcaaacgaagtaattgcttatatcagagaggttgtaaaagacatgtactctgaggaa
gtatctgaggaagttcgtattcagtatggaggcagtgttaagccttcgaatgttgaagag
attatgaatgaaagtgatattgacggagcacttgtgggaggagcctcattagaagcctct
gattttactgctttagtcaatttttaa

DBGET integrated database retrieval system