KEGG   Acetoanaerobium sticklandii: CLOST_0754Help
Entry
CLOST_0754        CDS       T01334                                 

Definition
(GenBank) Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit (modular protein)
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00010  Glycolysis / Gluconeogenesis
cst00020  Citrate cycle (TCA cycle)
cst00620  Pyruvate metabolism
cst00633  Nitrotoluene degradation
cst00640  Propanoate metabolism
cst00650  Butanoate metabolism
cst00680  Methane metabolism
cst01100  Metabolic pathways
cst01120  Microbial metabolism in diverse environments
cst01130  Biosynthesis of antibiotics
cst01200  Carbon metabolism
Module
cst_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0754
   00020 Citrate cycle (TCA cycle)
    CLOST_0754
   00620 Pyruvate metabolism
    CLOST_0754
   00640 Propanoate metabolism
    CLOST_0754
   00650 Butanoate metabolism
    CLOST_0754
  Energy metabolism
   00680 Methane metabolism
    CLOST_0754
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLOST_0754
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CLOST_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_2 Fer4_7 Fer4_16 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_4 Fer4_8 Fer4_17 Fer4_13 Fer4_22 Fer4_15 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CBH20880
UniProt: E3PWR5
Position
888460..888720
Genome map
AA seq 86 aa AA seqDB search
MSRNFITPIGDEGIYTLDTGSWRTFRPIMNKDNCVECGICMSFCPVGSITGNKQKIYAID
YKFCKGCGICAYECPSKAIDMVKEGD
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggaattttataactccaataggagatgaaggtatatatacgcttgatactgga
agctggagaacttttagaccgattatgaataaggataattgtgtagagtgcggaatatgt
atgagcttttgcccagtaggaagcatcactggaaataagcaaaaaatatatgctatagat
tataaattttgcaagggttgtggaatctgtgcttatgaatgtccatcaaaagcaatagat
atggtaaaggaaggggattaa

DBGET integrated database retrieval system