KEGG   Acetoanaerobium sticklandii: CLOST_1134Help
Entry
CLOST_1134        CDS       T01334                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00071  Fatty acid degradation
cst00280  Valine, leucine and isoleucine degradation
cst00310  Lysine degradation
cst00362  Benzoate degradation
cst00620  Pyruvate metabolism
cst00630  Glyoxylate and dicarboxylate metabolism
cst00640  Propanoate metabolism
cst00650  Butanoate metabolism
cst00900  Terpenoid backbone biosynthesis
cst01100  Metabolic pathways
cst01110  Biosynthesis of secondary metabolites
cst01120  Microbial metabolism in diverse environments
cst01130  Biosynthesis of antibiotics
cst01200  Carbon metabolism
cst01212  Fatty acid metabolism
cst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLOST_1134 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CLOST_1134 (atoB)
   00640 Propanoate metabolism
    CLOST_1134 (atoB)
   00650 Butanoate metabolism
    CLOST_1134 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLOST_1134 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CLOST_1134 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLOST_1134 (atoB)
   00310 Lysine degradation
    CLOST_1134 (atoB)
   00380 Tryptophan metabolism
    CLOST_1134 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLOST_1134 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLOST_1134 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLOST_1134 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cst04147]
    CLOST_1134 (atoB)
Enzymes [BR:cst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLOST_1134 (atoB)
Exosome [BR:cst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLOST_1134 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBH21254
UniProt: E3PXT9
Position
1284722..1285897
Genome map
AA seq 391 aa AA seqDB search
MREVVIVSAARTPIGSFGGSLAGVSAAELGITAAKGAIEKAKIDPKLIDTAIIGNVLSAG
LGQNIARQVSLGAGMSYESSSLTINKVCGSGLRAVSMAAQFIMLGDAEVVLAGGTESMTN
APYCSSSMRSGARMGNTQMVDTMINDALTDAFNGYHMGITAENIAEKWNLTREMQDEFAL
ASQLKAQKAIEEDKFKDEIVPVVIKSRKGEVIVDKDEYPKFDMTIDKLQKLKPAFKKDGT
VTAGNASGINDGAAMMIVMSREKADELGLEVMATIASYSSAGVDPAIMGYGPVPSTIKTL
EKANMKIEDLDLVEANEAFAAQSLSVVQDLKLNPEIVNVNGGAIALGHPVGASGARILTT
LLHEMKRRDAKNGLATLCIGGGMGTAIVVKR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgtaatcgtaagtgctgctagaacacctataggttcttttggcggaagc
ttggctggagtttctgctgctgagcttggaataacagcagcaaaaggggctattgaaaaa
gcaaaaattgacccaaaattgattgatactgcgataattggtaatgtgctttcagctgga
ctaggacaaaatatagcaagacaagtatcactaggtgctggcatgagctatgaatcatca
tcattaactattaataaagtttgtggctcgggtcttagagcggtttctatggcagctcaa
tttataatgcttggagatgctgaagtggttttagctggaggaactgaaagtatgacaaat
gctccttactgtagtagttcaatgcgcagcggggctaggatgggaaatactcagatggtt
gatactatgattaatgatgctcttacagatgcatttaatggatatcatatgggtattact
gcagagaatatagctgaaaaatggaatcttactagagaaatgcaagatgaatttgcccta
gcgagtcagttaaaagcacaaaaagcgatagaggaagataagtttaaggatgaaatagtt
ccagtagtaatcaagtctagaaaaggcgaagttatagttgataaagatgaatatccaaaa
tttgacatgactattgacaagttacaaaaattaaagcctgcatttaaaaaagatggtaca
gtgacagcaggaaatgcttctggaatcaatgatggcgcagctatgatgatagtaatgtcg
agagaaaaagctgatgagctaggtttagaagtaatggcaactattgcttcttactcatct
gctggagtagatccagctataatgggatacggaccagttccaagcacaataaaaacatta
gaaaaagcaaatatgaagattgaagatttagatttagtagaagcaaatgaagcatttgca
gctcagtcactttcagtagttcaagatttaaaattaaatccggaaatagtaaatgtaaat
ggtggagctattgctttgggacatccagtaggagcttctggagctagaatacttactaca
ttattacacgaaatgaaaagaagagatgcaaaaaatggacttgctactctttgtattggt
ggaggaatgggaacggctatagttgtaaaaagataa

DBGET integrated database retrieval system