KEGG   Acetoanaerobium sticklandii: CLOST_1290
Entry
CLOST_1290        CDS       T01334                                 

Gene name
oraE
Definition
(GenBank) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00472  D-Arginine and D-ornithine metabolism
cst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CLOST_1290 (oraE)
Enzymes [BR:cst01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CLOST_1290 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: CBH21410
UniProt: E3PY95
Structure
PDB: 

Position
complement(1449077..1451299)
AA seq 740 aa
MEKDLQLRVNEKLDVENILKDLDKYTPKRRGWTWRQPAENLQMGPFIYKDASTPLENSVA
LPSAKYFGDIDPQPLPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHYDGLI
EGTPQGIGGVPITRKQVRAQRKALDLIEEEVGRPINYHSYVSGVAGPDIAVMFAEEGVNG
AHQDPQYNVLYRNINMIRSFIDACESKTIMAWADMAQIDGAHNANATAREAWKVMPELMV
QHALNSIFSLKVGMKKSNICLSTVPPTAPPAPSMYLDLPYAVALREMFEGYRMRAQMNTK
YMEASTREATVTHVLNLLISKLTRADIQSTITPDEGRNVPWHIYNIEACDTAKQALIGMD
GLMDMVQLKREGVLGDTVRELKERAVLFMEEIIEAGGYFNAVEQGFFVDSGYYPERNGDG
IARQINGGIGAGTVFERDEDYMAPVTAHFGYNNVKQYDEALVSEPSKLIDGCTLEVPEKI
VYIDELDENDNVNVRMEETKEFRHSSMIKPEVEWQADGTVLLTMFLPTSKRVAEFAAIEF
AKKMNLEEVEVINREVMQEAEGTRIELKGRVPFSIDINSLVIPPEPEILSEDEIREDIEK
TPLKIVAATVGEDEHSVGLREVIDIKHGGIEKYGVEVHYLGTSVPVEKLVDAAIELKADA
ILASTIISHDDIHYKNMKRIHELAVEKGIRDKIMIGCGGTQVTPEVAVKQGVDAGFGRGS
KGIHVATFLVKKRREMREGK
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggaaaaagatctacagttaagagttaatgaaaaacttgacgttgaaaatatattaaaa
gaccttgataaatatactccaaaaagaagaggttggacatggagacagccagctgaaaat
cttcaaatgggaccttttatttataaagatgcttctactcctttagaaaatagtgttgca
ctaccatcagcaaaatattttggtgatatcgatccacaaccacttccagtaatcacaaca
gagattgcttcaggaagatttgaagatgatattaggcgtatgagaatggctgcttggcat
ggagctgaccatataatggttatccgtacagctggacaatctcactacgatggtttaatt
gaaggaactcctcaagggattggtggagtacctataactagaaagcaagttagagctcag
cgtaaagcccttgatttaattgaagaagaagtaggaagaccaattaactatcattcatat
gtttctggagttgcaggtccagatatagcagttatgtttgctgaagaaggagttaatgga
gctcaccaagatccacaatacaacgtactatacagaaatattaatatgattcgttctttt
atagatgcttgcgaatcaaaaactatcatggcatgggctgatatggctcagatagatgga
gcgcataatgcaaacgctacagctagagaagcttggaaagtaatgcctgaacttatggtt
cagcatgcgttaaactcaatattctcgcttaaagttggaatgaaaaaatcaaatatctgc
ttatctacagttcctcctactgctccaccagcaccgtctatgtatttagatttaccatat
gcagtggcacttagagagatgtttgaaggatatagaatgagagcacagatgaatacaaag
tatatggaagcatctactagagaagctactgtaactcatgttctaaatcttcttatatct
aaacttacaagagcagatattcaatctacaattactcctgacgagggaagaaacgttcct
tggcatatatacaatatagaagcttgcgatacagcaaaacaagctctaattgggatggat
ggattaatggatatggttcagcttaaaagagaaggcgttcttggcgacacagtaagagag
cttaaagaaagagctgttctatttatggaagaaataattgaagctggcggatatttcaat
gctgttgagcaaggattctttgttgactcagggtactatccagaaagaaatggagatgga
atcgcaagacaaataaatggaggaattggtgcaggaactgtatttgagagagatgaagac
tatatggctccagttacagctcactttggatacaacaatgttaagcaatacgacgaggca
ttagtatctgaaccttcaaagttaatcgatggttgtactttagaagtaccagaaaaaatt
gtatatatcgatgagctagatgaaaatgataacgttaacgttagaatggaagaaactaaa
gagtttagacattcctcaatgattaaacctgaagttgagtggcaagcagacggtacagtt
cttttaactatgttccttccaactagtaaaagagtagcagaatttgccgctattgaattt
gctaaaaagatgaacttagaagaagtcgaagttattaacagagaagtaatgcaagaagct
gaaggaactagaatagagttaaaaggaagagttccatttagcatagatatcaacagcctt
gttattcctccagagccagaaatactttctgaagatgaaataagagaagatatcgaaaaa
actccacttaaaatagttgcggcaactgtaggagaagatgagcattcagttggtctaaga
gaagtaatagatattaaacatggcggtattgaaaaatatggtgttgaagttcattatcta
ggaacatctgtacctgttgagaagctagtagatgctgctatagaattaaaagcagatgct
atattggcttcaactattatcagtcatgatgatatccattataaaaatatgaagcgcatt
catgagctagctgtagaaaaaggtatccgtgataagattatgatcggatgcggaggaact
caggttactccagaggttgcagttaagcaaggtgtggatgcgggatttggtagaggttca
aaaggtattcatgttgcaactttccttgttaagaaaagaagagagatgagagaagggaaa
taa

DBGET integrated database retrieval system