KEGG   Acetoanaerobium sticklandii: CLOST_1291
Entry
CLOST_1291        CDS       T01334                                 

Gene name
oraS
Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00472  D-Arginine and D-ornithine metabolism
cst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CLOST_1291 (oraS)
Enzymes [BR:cst01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CLOST_1291 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: CBH21411
UniProt: E3PY96
Structure
PDB: 

Position
complement(1451299..1451664)
AA seq 121 aa
MKRADDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFS
SLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQIFKGGV
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagagcagacgattttcaacaaagaagagctcatttagctaacttaagcgacgaa
gagcttcaaacaagattttgggaaatggcagaaaaaatagttgatccattactggattta
gggaaaaagaatacaactccttcaattgaaagatctgtacttcttcgtatgggattctca
tctttagaagctaaagcaatagtagataaaactatggatagagggcttatgggaaaaggt
gctggtcatatagtttacaaaatagcgaaagaaaaaaatatctctgttagagaagctgga
cttgcattaagtgaaggcaagtactgggatgatgctattcaaattttcaaaggaggagta
aaataa

DBGET integrated database retrieval system