KEGG   Acetoanaerobium sticklandii: CLOST_1359Help
Entry
CLOST_1359        CDS       T01334                                 

Gene name
selD
Definition
(GenBank) selenophosphate synthase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00450  Selenocompound metabolism
cst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CLOST_1359 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cst03016]
    CLOST_1359 (selD)
Enzymes [BR:cst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CLOST_1359 (selD)
Transfer RNA biogenesis [BR:cst03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    CLOST_1359 (selD)
 Prokaryotic type
    CLOST_1359 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: CBH21479
UniProt: E3PRH5
Position
complement(1520197..1521171)
Genome map
AA seq 324 aa AA seqDB search
MAKALEKIPQKYHENLIVGYEHSDDAAVYKIDNDKALIQTLDFFTPVVDDPYLFGSIAAA
NSLSDIYAMGGKPILAMNIVCFPNCLDMEILGEILRGGYEKVAESGAILVGGHSVEDDEP
KYGLSVTGMTNPKNVLTNAGAKEGDLLVLTKPLGSGILNTAIKGDIIEKSHYEEVVKIMS
YLNMYAAIPFEKLKVHAVTDITGFGLIGHLVEMAKGSNTTIVIETKTIPVIDGAFDYAKM
GIIPAGMYNNREYFEHEVIYQNDKFKSSILCDILYDPQTSGGLLVSLPESEAIEYMKILN
STQAIKCEIIGRVTSKKDKYIVLE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaagcattagaaaaaattccacaaaaataccatgaaaatttaatcgtaggctat
gagcattctgatgatgcagctgtttataaaatagataatgacaaggcattaatacaaact
ctggacttctttactcctgtagttgatgatccatatctttttgggagtatagctgcggca
aattcattatccgatatttatgctatgggaggcaagccaatcttagctatgaatattgtt
tgcttcccaaactgcttagatatggagattctaggtgaaatcttaagaggtggatatgag
aaggtagcagaatctggagctattttagtgggaggtcattctgttgaagatgatgaaccg
aaatatggtctttctgttacaggaatgacaaatcctaaaaatgtacttacgaatgctgga
gcaaaagagggagacctactagttttaactaaacctttaggaagcggtatactaaatacg
gctattaaaggagatattatagaaaaatctcattatgaagaagtagttaaaataatgagt
tacttaaatatgtatgcagctataccttttgagaagctaaaagtgcatgctgtaacagat
ataacaggatttgggcttataggacatcttgtggaaatggctaaaggttcaaatactact
attgttattgaaacaaaaactattccagtcattgatggtgcctttgattatgcgaaaatg
ggaattattccagctggaatgtacaacaacagagaatactttgagcatgaggttatatat
caaaatgataaatttaagtcatctattctatgtgacattttatatgatcctcagacatca
ggaggacttttggtaagcttgccggagagtgaagctatagagtatatgaaaattttaaat
tcaactcaagcaataaaatgcgaaataataggtagagtaacaagtaagaaagataaatat
atagtactggagtag

DBGET integrated database retrieval system