KEGG   Acetoanaerobium sticklandii: CLOST_1979Help
Entry
CLOST_1979        CDS       T01334                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00260  Glycine, serine and threonine metabolism
cst00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cst01100  Metabolic pathways
cst01110  Biosynthesis of secondary metabolites
cst01130  Biosynthesis of antibiotics
cst01230  Biosynthesis of amino acids
Module
cst_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLOST_1979 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLOST_1979 (trpB)
Enzymes [BR:cst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLOST_1979 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBH22099
UniProt: E3PT95
Position
complement(2111705..2112892)
Genome map
AA seq 395 aa AA seqDB search
MERNNGYFGQFGGAFVPEELKNVLKDVEEAFYKYIEDEEFLSELAYYQRQYIGRENPLYL
AKRLSEQLGGAKIYLKREDLNHTGAHKINNAMGQVLLAKRMGKKRIIAETGAGQHGVATA
TVCALMGLECIIYMGAIDIKRQELNVFRMEMLGAKVVPVTTGTATLKDAVDEALADFVAN
AHDTFYLLGSAVGPHPYPTMVREFQSVIGKEARKQILEVEGKLPDYIVACVGGGSNAIGL
FAPFVDDLSVKIVGVEPGGKGLDTNEHAASISKGSVGVIHGFKCYTLQDENGEPLPVHSI
AAGLDYPGVGPEHSYYKESNRAEYIAITDDEAMQAFFLLSRTEGIIPAIESAHAVAYAVK
LAKTLSKDQTIIVNLSGRGDKDVNQVKEMNLLDKN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaataatggttattttggacaatttggaggagcctttgtacctgaggaatta
aaaaatgtactaaaagatgtagaggaagctttttataagtacatagaagatgaggagttt
ttaagtgagcttgcctactaccagcgccaatatataggacgtgaaaatcctctatacctt
gcaaaaagattatctgagcaactaggaggagctaagatttatttgaaaagagaggatttg
aaccatacaggagctcacaaaataaacaatgcaatgggacaggtgcttttggcaaagaga
atgggcaaaaagagaataatagcagaaactggagctggacagcatggagtggcaacagca
acggtatgtgctctgatgggactggaatgcatcatctacatgggagctatagatataaaa
agacaagagctaaatgtctttaggatggagatgctaggggctaaagtagttcctgtaact
acagggacagcaactctaaaggatgcagtagacgaagctttagctgattttgttgcaaat
gctcacgatacattctatcttctaggctcagcagttggaccacatccatatcctacaatg
gtaagagaatttcaaagcgtaataggaaaagaagcaagaaagcaaatcttagaagtagaa
ggtaaactgcctgattatatagtagcctgcgtaggaggaggaagtaatgcaataggattg
tttgcaccatttgtagatgacctctcagtaaaaattgtaggagtagagccaggaggaaaa
ggactagacacaaatgaacatgctgcatctatttctaaaggaagcgtaggagttattcat
ggcttcaaatgctatactttacaagatgaaaatggtgagcctcttccagttcattctata
gctgctggacttgactatcctggagtagggccagagcatagctattacaaagaaagtaat
agagctgagtacattgctataacagacgatgaggcgatgcaggcattctttcttctatct
agaactgaaggcataataccagcgatagaaagcgctcatgcggttgcatatgcagtaaag
ctagcaaaaaccttgtcaaaagatcagacgatcattgtcaatctatcaggtagaggagat
aaagacgtaaatcaagtaaaagaaatgaacttattagataaaaactga

DBGET integrated database retrieval system