KEGG   Corynebacterium stationis: CSTAT_10735Help
Entry
CSTAT_10735       CDS       T04724                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
csta  Corynebacterium stationis
Pathway
csta00471  D-Glutamine and D-glutamate metabolism
csta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CSTAT_10735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csta01011]
    CSTAT_10735
Enzymes [BR:csta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CSTAT_10735
Peptidoglycan biosynthesis and degradation proteins [BR:csta01011]
 Precursor biosynthesis
  Racemase
   CSTAT_10735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: APT95739
Position
complement(2289070..2289843)
Genome map
AA seq 257 aa AA seqDB search
MDRLAPIGIFDSGVGGLTVARTIMEQLPQESIIYVGDTAHAPYGPRELEDVRNLSREIGD
DLVARGCKMLVIACNTATAAFLDEARERYDIPVVEVIRPAVRRALATTRNHKVGVIGTEG
TINSQAYQRLFAQDEQVEALAVACPDFVPFVERGITSGRQILGVAEAYLAPLQAAGVDTL
VLGCTHYPLLTGIIQLAMGDNVTLVSSAEETAKDVLRILTEHDELAPVDNKPLRKFESTG
DPETFSRLAQRFLGPQL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcttagctcccatcggcatctttgattcaggtgtcggtggcttaactgttgcg
cgcacaatcatggagcaattgccgcaggaatccatcatctatgtcggggataccgcccac
gcgccatatggtccgcgggaattagaagatgtgcgaaacctttcgcgcgaaattggtgat
gacctagtggcacgcggctgcaagatgttggtgattgcgtgtaataccgctaccgcagca
tttctggatgaagcccgtgagcgctatgacatccccgtggtggaagtcatcaggccggcc
gtacgccgtgcgcttgcgacaacacgcaatcacaaggtcggtgtcattggtacagaagga
actattaattcccaggcttaccagcgtctttttgcccaagatgagcaggtagaagcactt
gccgtggcatgtccggattttgtgccttttgtggaacgcggtattacttccggaaggcag
attctcggggtggcagaggcatatcttgcaccgctgcaagcggccggagtggatactttg
gtgctgggttgtacgcactatcccttgctgaccggcattattcagctggccatgggcgat
aatgtcacattggtgtcttcagcagaggagacagcgaaagatgttttgcgcattttgacc
gagcacgatgaactcgcacccgtggataataagccccttcgcaaatttgagtccacgggt
gatccagaaactttttcgcgcctggcacagcgatttctggggcctcagctgtag

DBGET integrated database retrieval system