KEGG   Corynebacterium stationis: CSTAT_11040Help
Entry
CSTAT_11040       CDS       T04724                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
csta  Corynebacterium stationis
Pathway
csta00020  Citrate cycle (TCA cycle)
csta00620  Pyruvate metabolism
csta00650  Butanoate metabolism
csta01100  Metabolic pathways
csta01110  Biosynthesis of secondary metabolites
csta01120  Microbial metabolism in diverse environments
csta01130  Biosynthesis of antibiotics
csta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSTAT_11040
   00620 Pyruvate metabolism
    CSTAT_11040
   00650 Butanoate metabolism
    CSTAT_11040
Enzymes [BR:csta01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CSTAT_11040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans Phage_rep_org_N baeRF_family10
Motif
Other DBs
NCBI-ProteinID: APT95785
Position
complement(2344140..2345645)
Genome map
AA seq 501 aa AA seqDB search
MSDRIGNYKDLVMSAEEAAQFVNHGDVVGISGFTGAGYPKALPTAIAEKAKAAHEKGEEF
QIDLYSGASTAPDCDGVLAEANALRFRSPYNSDPILRNKANAGEILYQDIHLSHSGQQVE
EGFNGDFQVAIIEVVRILEDGNIVPSSAVGNNLEYIEAADKIILEVNSWQSENLEGMHDI
YRVAKLPNRQPIPITKVEDRIGETFIELPSEKVVAVVETNAPDRNAPFRAPDEVSEKIAQ
NFIHFLEGEVEAGRLEYDGFIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVIQDGMLDLI
DAGKMTVASATSFALSPEYADKMNENADRYKESIILRPQQISNHPEVIRRVGLISSNGMI
EADIYGNINSTNVGGSRIMNGTGGSGDFTRNGYITTFVSPSVAKDGAISAIVPFASHIDH
TEHDTMVIITEYGVADLRGLAPRERVERIIAVAHPDYRPMLQDYFDRAMQNKFVHTPHDL
ATAFEFQRNFAEYGDMRGEQK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgacaggattggtaattacaaggatctggtcatgtctgctgaagaagcagcacag
ttcgtcaaccacggcgacgttgtaggcatctccggctttaccggtgctggctacccaaag
gctttgccaaccgctatcgcggaaaaggctaaggctgcgcatgaaaagggcgaagagttc
cagattgacttgtactctggcgcatctaccgctcctgattgtgacggtgtattggcggaa
gcaaacgcactgcgtttccgttccccttacaactccgatccaattctgcgtaacaaggct
aacgctggcgagatcctgtaccaggatattcacctttctcactctggtcagcaggttgaa
gagggcttcaatggtgacttccaggttgcgattattgaggtagttcgcattcttgaggac
ggcaacatcgttccttcctccgcggttggtaacaacctcgagtacatcgaagctgctgac
aagatcatcttggaagttaactcttggcagtcggagaaccttgagggcatgcacgatatc
taccgtgttgccaagcttcctaaccgtcagccaattccaatcaccaaggttgaagaccgt
attggtgaaaccttcatcgagctgccttcggagaaggttgtcgcagttgttgaaactaac
gcgccagaccgcaacgctcctttccgcgcaccagatgaggtctcggaaaagattgctcag
aacttcatccacttcctagagggcgaagttgaagctggccgcctagagtacgacggcttc
atcatgcagtccggcgtgggcaacgttcctaacgctgtgatggctggtcttttggactcc
aagttcgaaaacattaaggcctacaccgaggttatccaggacggcatgctggacctgatc
gacgcgggcaagatgaccgttgcttccgctacctctttcgctttgtctcctgagtacgca
gacaagatgaacgagaacgctgaccgctacaaggaaagcatcatcctgcgtccgcagcag
atctctaaccacccagaggttatccgtcgtgtcggtctgatttcttccaacggcatgatt
gaggccgatatttacggcaacatcaactcgaccaacgttggcggctcccgcatcatgaac
ggcaccggtggttctggtgacttcacccgtaacggctacatcaccaccttcgtgtcccca
tcggttgctaaggacggcgctatttctgcgattgttcctttcgcttcccacattgaccac
actgagcacgacaccatggtcatcatcaccgagtacggtgtagctgacctgcgtggcctg
gctccacgtgagcgtgttgagcgcatcattgcggttgcacaccctgattaccgtccaatg
ctgcaggactacttcgatcgtgcaatgcagaacaagttcgttcacactccacacgacttg
gctaccgcgttcgagttccagcgcaacttcgctgagtacggcgatatgcgcggcgagcag
aagtaa

DBGET integrated database retrieval system