KEGG   Corynebacterium stationis: CSTAT_12735Help
Entry
CSTAT_12735       CDS       T04724                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csta  Corynebacterium stationis
Pathway
csta00071  Fatty acid degradation
csta00072  Synthesis and degradation of ketone bodies
csta00280  Valine, leucine and isoleucine degradation
csta00310  Lysine degradation
csta00362  Benzoate degradation
csta00380  Tryptophan metabolism
csta00620  Pyruvate metabolism
csta00630  Glyoxylate and dicarboxylate metabolism
csta00640  Propanoate metabolism
csta00650  Butanoate metabolism
csta00900  Terpenoid backbone biosynthesis
csta01100  Metabolic pathways
csta01110  Biosynthesis of secondary metabolites
csta01120  Microbial metabolism in diverse environments
csta01130  Biosynthesis of antibiotics
csta01200  Carbon metabolism
csta01212  Fatty acid metabolism
csta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSTAT_12735
   00630 Glyoxylate and dicarboxylate metabolism
    CSTAT_12735
   00640 Propanoate metabolism
    CSTAT_12735
   00650 Butanoate metabolism
    CSTAT_12735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSTAT_12735
   00072 Synthesis and degradation of ketone bodies
    CSTAT_12735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSTAT_12735
   00310 Lysine degradation
    CSTAT_12735
   00380 Tryptophan metabolism
    CSTAT_12735
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CSTAT_12735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSTAT_12735
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSTAT_12735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csta04147]
    CSTAT_12735
Enzymes [BR:csta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CSTAT_12735
Exosome [BR:csta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSTAT_12735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APT96089
Position
2708638..2709873
Genome map
AA seq 411 aa AA seqDB search
MTNHNDNDIVFCSPLRTPVGRYGGVFKDIPVEDLATTVVDAIVERTGITAKDVDDIILGQ
ASPNGAAPALGRIVALNSALGKEVPGMQLDRRCGSGLQALMTAAAHVAVGAADLIIAGGA
ESMSRTEYTVDGSIRWGVKGGDMQLRDRLAEARETAGGKNHPIPGGMIETAENVRREYKL
TREAQDQMAAASHERALKAQAENWFEEEIVPVTVPAKKRGQEPTVVTADEGPREGSTPEK
LAQLRSIRGKQDEEATVTAGNASSQNDGAAAMIVTTRAKAAELGLTPMLSLKGWAVAGVA
PETMGVGPVPATKKALERTGVSLDDLDAIELNEAFAAQALAVLQEWDLAWDDSRLNTWGS
GISLGHPVGATGARMLVTLAHRLKREGGQLGLATMCIGGGQGMAAVVEKEG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccacaacgataatgacattgtcttttgctccccactgcgcactccagtggga
cgctacggcggagtattcaaggatattccggtagaagatctggctaccaccgtggtcgat
gccatcgtggagcgcaccgggatcaccgccaaggacgtagacgacattatcttgggccag
gcgagcccgaatggtgcagcaccagcacttggtcgcatcgttgcgctgaactcggccttg
ggcaaggaagtaccgggcatgcagctggatcgccgttgtggttcgggcctgcaggcactc
atgaccgcggccgcacacgttgcagtcggcgcagctgacctgattatcgcgggtggcgcg
gagtccatgtcgcgcaccgagtacaccgttgacggttccatccgctggggtgtcaagggc
ggcgacatgcagctgcgtgaccgcctggctgaggcacgcgagaccgctggcggcaagaac
cacccaattcctggcggcatgatcgaaacggctgaaaacgttcgccgcgagtacaagctc
acccgcgaagcacaggaccagatggcagcagcatcgcacgagcgcgcgctgaaggcccag
gcagagaactggttcgaggaagaaatcgtgccagtcaccgttcctgccaagaagcgtggc
caggagccaaccgtcgtgaccgccgatgagggcccacgcgagggttccaccccagaaaag
cttgctcagctgcggtctatccgcggcaagcaggatgaagaagcaaccgtgaccgcgggc
aacgcatcctcgcaaaacgatggcgccgcagccatgattgttactacccgcgccaaggcc
gctgagctggggcttaccccgatgttaagcctcaagggctgggctgttgcaggtgttgcg
ccagagaccatgggcgttggtccagttccagcaaccaagaaggcactggagcgcaccggc
gtcagcttggatgacctggatgccatcgagctcaacgaggctttcgcagcgcaggcactc
gctgtgctgcaggaatgggacttggcgtgggatgattcccgcctgaacacttggggctct
ggcatctccttgggccacccagttggtgcgaccggtgctcgcatgttggtgactttggca
caccgcctcaagcgcgagggcggccagctgggtcttgccaccatgtgcatcggtggcggt
cagggcatggcagcagttgtagaaaaggaaggctag

DBGET integrated database retrieval system