KEGG   Corynebacterium striatum: CBE89_08600Help
Entry
CBE89_08600       CDS       T05059                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cstr  Corynebacterium striatum
Brite
KEGG Orthology (KO) [BR:cstr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cstr03009]
    CBE89_08600
Enzymes [BR:cstr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CBE89_08600
Ribosome biogenesis [BR:cstr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CBE89_08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ART21555
UniProt: A0A2Z2J209
Position
complement(1817146..1818012)
Genome map
AA seq 288 aa AA seqDB search
MLSHIIDVLADPYDGSALTGADDFTRLVSGSGHSFDVAKQGYVTLSAGAGLKHKGDSIEM
VNARETFLSLGHFAPFVEAVTGAVQDALDAAELPETVAPTLLEVGAGTGYYLAHTLDSIA
DARGVGLDISPHAAKHLAKCHPRVGAVVADVWERLPLQDDSVDAISVVFAPRNPAEFQRI
LRPGGEVIVLTPGVGHLDELREPLGILGVEEGKIERMYEQAAGHLEQAADPVDLSFPMNL
DRASIAAQVGMSPSAHHLSTEVLAERMELLPESMTVTARARLDRLRAV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacacatcatcgatgttctggccgacccatacgatggctctgctctcaccggt
gcggatgattttacccgcctggtatcgggatcgggtcattcctttgatgtagccaagcaa
ggctacgtcaccctctcggcaggcgcagggcttaaacataagggcgactccatcgagatg
gtcaatgcccgtgagaccttcctctccctcgggcactttgcgccgttcgtggaagctgtc
actggcgcggtccaggatgcacttgatgcagccgaactaccagaaaccgttgccccgact
ctgcttgaagtaggtgctggcaccggctattacctagcgcacaccctcgactccatcgcg
gacgcacgcggcgtcggcctcgatatttcaccacatgctgccaagcatttggcaaagtgc
cacccacgcgtcggcgcagttgtagcggatgtgtgggaacgccttccgttgcaggacgat
tcggtggatgcgatttccgtagtctttgcccctcgcaacccagccgagtttcagcgtatt
ttgcgcccgggtggcgaagttatcgtcttgacccctggtgtggggcacttggatgaattg
cgcgaacctctaggaatcttgggcgtagaggaaggcaagattgagcgcatgtacgagcaa
gccgcaggccatctcgaacaagcagccgaccccgtggacctatccttcccgatgaacctc
gaccgcgcttccatcgcagcgcaggtgggaatgagcccttcggcccaccacctcagtact
gaagttcttgcagagcggatggagctgcttcctgaatctatgacggttactgcgcgtgcg
cgtctcgaccgattgcgcgcagtataa

DBGET integrated database retrieval system