KEGG   Corynebacterium striatum: CBE89_12140Help
Entry
CBE89_12140       CDS       T05059                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cstr  Corynebacterium striatum
Pathway
cstr00061  Fatty acid biosynthesis
cstr00071  Fatty acid degradation
cstr01100  Metabolic pathways
cstr01212  Fatty acid metabolism
cstr02024  Quorum sensing
Module
cstr_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cstr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBE89_12140
   00071 Fatty acid degradation
    CBE89_12140
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CBE89_12140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cstr01004]
    CBE89_12140
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cstr04147]
    CBE89_12140
Enzymes [BR:cstr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CBE89_12140
Lipid biosynthesis proteins [BR:cstr01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CBE89_12140
Exosome [BR:cstr04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CBE89_12140
  Exosomal proteins of breast cancer cells
   CBE89_12140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ART22157
UniProt: A0A2Z2J6C8
Position
2542958..2544676
Genome map
AA seq 572 aa AA seqDB search
MSAFDTKEWLQFYPEWTPHNLDYGDTTLLDIYDNNLAINPDKPATYFFGKTQTFAEMDKQ
VRRAAAGLRAFGVRPGDKVAIVAPNCPQYVVAFYAILKLGAIAVLHNPLYTAHELEGLFK
DHGARIAIAWDKTASTLEKLRDTTNLETVISINMIDAMPTTQKMALKYLPFLKSKREQLS
THAKNTVTWDSLVGNAIGGDGRDVKPPADITKDTIAVIMYTSGTTGQPKGAQLSHGNFFA
VILQGKHWVPGLGDKPERMLCALPFFHAYGLVMNVVLQPLIGGELVIIPKPDISLIMGLM
KKHTPTWVPGVPTLYERIVKSAEEQNIDIKGVRAAFSGASTLPVDTVEKWEEYTGGLLVE
GYGLTECSPIIVGNPMSTDRRPGYVGIPFPDTEIRIANPDNLDETQPDGVEGEVLARGHQ
VFKGYLNNPEATEAAFHDDWFRTGDMGIMEEDGFIRLVSRIKEIIITGGFNVYPGEVEEV
LRTHPAIDDVAVVGRPRSDGSEDVVACIDLADGVALDPEGLKEFCRERLTRYKVPRTFYH
FEELAKDQMGKIRRREVQADLLERLEKESAGQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcattcgacaccaaggaatggctccagttctacccagaatggaccccacataac
cttgactacggagataccactctcctcgatatttacgacaacaacctggcaatcaaccct
gacaagccagcgacttacttctttggcaagacccagaccttcgcggagatggacaagcag
gtccgtcgcgccgccgccggtctgcgcgcattcggcgtgcgcccgggtgacaaggtggcc
atcgtggcgccgaactgcccgcagtacgtagttgctttttacgccattttgaagctgggt
gccatcgcggtcctccacaacccgctctacactgcgcacgagctggaaggtctgttcaag
gaccacggcgcccgcatcgctattgcctgggacaagacggcttccaccctggagaagctg
cgcgacaccaccaatctggagacggtcatctctatcaacatgattgatgcgatgccaacg
actcagaagatggcgctgaagtacctgccatttctaaagtccaagcgcgagcagctttct
acccatgcaaagaacaccgtcacctgggacagcctggtgggcaatgccatcggcggcgac
gggcgcgacgtaaaacctccggcggacatcaccaaggacaccattgccgtcatcatgtac
acctccggcactacagggcagccgaagggcgcgcagctttcgcacggcaacttctttgcc
gttattttgcagggcaagcactgggtacctggcctgggcgacaagccggagcgcatgctc
tgcgcgctgcctttcttccacgcttatggcctggtcatgaacgtcgtcctgcagccgctc
atcggtggcgagctggtcatcatcccgaagccggacatctccctcatcatgggcttgatg
aagaagcacactccgacgtgggttcccggtgtgccgaccctctacgagcgcatcgtcaag
tctgctgaggagcagaacatcgacatcaagggcgtgcgtgcggcattctccggcgcctcg
accttgccggtggacaccgtagagaagtgggaagaatacaccggcggcctgctggttgaa
ggctatggcctaaccgagtgctcccccatcatcgtgggcaacccgatgagcaccgatcgc
cgcccaggttacgtgggtatcccgttcccggataccgagatccgcatcgcaaacccggac
aacctggacgaaactcagcccgacggcgtcgagggtgaggtcctcgctcgcggccaccag
gtattcaagggctacctcaacaaccctgaggccaccgaggctgctttccacgacgactgg
ttccgcaccggcgacatgggcatcatggaagaagacggcttcatccgcctggtctcccgt
atcaaggaaatcatcatcaccggcggcttcaatgtctacccaggtgaggttgaggaagtg
ctgcgtacgcaccctgccattgacgacgtcgccgtggtcggccgcccgcgctccgacggt
tccgaggacgtcgtggcctgcatcgacctagccgacggcgtggcgcttgacccagaaggc
ttgaaggaattctgccgcgagcggctcacccgctacaaggtcccgcgcaccttctaccac
ttcgaggaactggccaaggaccaaatgggcaagattcgccgccgcgaagtccaggccgat
ctgctcgagcgcctagaaaaggagtctgctgggcagtag

DBGET integrated database retrieval system