KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C1467Help
Entry
CSUB_C1467        CDS       T02904                                 

Definition
(GenBank) 4-nitrophenyl phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Pathway
csu00627  Aminobenzoate degradation
csu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CSUB_C1467
Enzymes [BR:csu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     CSUB_C1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase Myotub-related
Motif
Other DBs
NCBI-ProteinID: BAJ51318
UniProt: E6N8C5
Position
complement(1431494..1432288)
Genome map
AA seq 264 aa AA seqDB search
MKVTLEKVKGLVLDMDGTIYIGSKPLPGAPEAVNRLRKKLKLVFMTNNSTLTRTQYLEKL
NRMGIHAYVSEILTSGYLAARYVATEHPGAHVLVVGEEGISREALQLGLRIIDHSQWKLA
EYVVAGLDRGFTYQKAANASQAIRNGAKFIATNLDNIYPTEEGFMPGAGSIIAMLSAATG
VKPFSVGKPSPISSQMALETLGLQASEVVFVGDRVDTDVAAARAVGARCILVKTGAFELF
RDKISEADMVVDSLVELPSLLSLE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggttacgctggaaaaggttaaaggcctcgtcctcgacatggacggcaccatctac
ataggctccaagccgcttccaggcgcacccgaagccgtcaacagactccgcaaaaagctg
aagcttgtttttatgacaaacaactccaccctgacaagaactcagtatctcgagaagcta
aaccgcatgggaatccatgcctatgtctcagagattttgacatctggttatctagcggcc
aggtatgtggcgacagagcatcctggggcccatgtcctcgtcgtgggggaagagggcata
tcaagagaggctctgcagctggggctgcggattatagaccacagccaatggaagctggcc
gaatacgtggtagcaggtctggacagaggcttcacttatcagaaagccgcgaacgcctcc
caagctataagaaatggtgcaaaattcatagcgacaaacctcgacaacatctatcctaca
gaagaagggtttatgccgggagcgggctccatcatagccatgctttcagccgccactggc
gtgaaaccattttcggtgggtaagccgtcgccaatctcctctcaaatggctttggagact
ctaggtctccaggcctcagaggtggtttttgtaggcgaccgtgtcgacaccgacgtggca
gcggcaagggctgtgggggctcgatgcatacttgtgaaaaccggtgcctttgagctcttc
agagacaagatatcggaggcagacatggttgtagacagccttgttgagctgccgagcctc
ctgtcgctcgagtaa

DBGET integrated database retrieval system