KEGG   Cucumis sativus (cucumber): 101202808Help
Entry
101202808         CDS       T02486                                 

Definition
(RefSeq) uncharacterized LOC101202808
  KO
K06195  ApaG protein
Organism
csv  Cucumis sativus (cucumber)
Brite
KEGG Orthology (KO) [BR:csv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    101202808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 101202808
NCBI-ProteinID: XP_004152556
UniProt: A0A0A0LWB4
Position
1
AA seq 287 aa AA seqDB search
MHSLSFKVVGGFNAGSRMNLPRRVPEMEVGAMRCFGGRRAFGRSCRIVACASERNIGDGG
EGQSQSASTSRSRSFLSRSETYALLKQQLEVAAKSEDYEEAARIRDSLKLFEEEEPVLRL
RRLMKEAISSERFEDAAKYRDELNEIAPHCLLKCASDATTLGIRVQVRSVYIEGRSQPSK
NQYFFAYRIRITNNSNRPVQLLRRHWIITDANGKTENVWGVGVIGEQPVILPKTGFEYSS
ACPLTTANGRMEGDFEMKYIDRVGEQSFNVAIAPFSLSIIGDSTEAF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgttgagctttaaagttgtaggtggttttaatgcgggatcgaggatgaattta
ccgagacgtgttccggaaatggaggttggggcaatgaggtgttttgggggccgtcgagca
tttggaaggtcttgtaggattgtagcatgtgcttcggagagaaatattggtgatggcggt
gaaggacagagtcagagtgcgagtacgagtcggagtcgttcgtttctctcccgcagtgaa
acttatgcactactgaagcagcaattggaggttgctgccaagtccgaggactatgaagaa
gctgcaaggatccgtgactcgttaaaattatttgaagaggaagagccagttctgcgcctc
cgaagactgatgaaggaagccatttctagtgagaggtttgaggatgctgctaaatatcgc
gatgagctgaatgaaattgctcctcactgtcttctgaaatgtgcaagtgatgcaacaact
ttgggtatcagggtacaagttaggagcgtttacatagaaggccgaagccaaccttcaaag
aatcagtacttttttgcataccgaataagaataaccaacaattcaaaccgtccagttcaa
cttctcagaagacattggattatcactgatgcaaatgggaaaacagaaaatgtctggggc
gttggtgttattggtgaacaaccagttatacttcctaagactgggtttgaatattcatca
gcatgcccattaactacagctaatggcagaatggaaggtgactttgaaatgaagtacatc
gatcgagtgggtgaacaatcatttaacgttgctattgctccattttccctctccataata
ggagatagcacagaagctttctaa

DBGET integrated database retrieval system