KEGG   Cucumis sativus (cucumber): 101205061Help
Entry
101205061         CDS       T02486                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00350  Tyrosine metabolism
csv00360  Phenylalanine metabolism
csv00380  Tryptophan metabolism
csv00950  Isoquinoline alkaloid biosynthesis
csv00965  Betalain biosynthesis
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101205061
   00360 Phenylalanine metabolism
    101205061
   00380 Tryptophan metabolism
    101205061
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    101205061
   00950 Isoquinoline alkaloid biosynthesis
    101205061
   00965 Betalain biosynthesis
    101205061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csv04147]
    101205061
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101205061
    4.1.1.105  L-tryptophan decarboxylase
     101205061
Exosome [BR:csv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101205061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 101205061
NCBI-ProteinID: XP_004152005
Position
3
AA seq 486 aa AA seqDB search
MDNELKPMDAEQLREHAHKMVDFIADYYKNIEDFPVLSQVEPGYLQNLLPESAPLNPESL
QSVLDDVQKKIFPGVTHWQSPNYFAYYPSNSSIAGFLGEMLSAAFNVIGFSWVTSPAATE
LEMIVLDWLAKLLKLPDDFLSSGNGGGVIQGTASEAVLVVLLAARDRALRRFGKDYLKKL
VVYASDQTHSALQKACQIGGIHPENCRWLKADISTNYALSPDVLSEELSRDTARGLIPFF
LCATVGTTSSTAVDPLPELGTIAKRHEMWFHVDAAYAGSACVCPEYRQYIDGVEEADSFN
MNLHKWFLTNFDCSALWIKDRHALIRSLSTNPEFLKNKASEAELVVDYKDWQIPLGRRFR
SLKVWMVLRLYGTENLQKYIRNHISLAERFEALVREDPRFEIVTPRIFSLVCFRLLPSRK
NEDGGNRLNQSLLDAVNASGNIFISHTVLSGKYILRFAVGAPLTEEKHINSAWKLLQDVA
STLLAI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaattgaagccgatggatgctgagcaactcagagaacatgctcataaaatg
gtggatttcattgctgattattacaaaaacatcgaggatttccccgtgctcagccaagta
gagcctggttatcttcaaaatcttctaccagaatctgcacctcttaatccagaatctctg
caaagtgttcttgatgatgtccagaaaaagatttttccgggtgtaacacattggcagagt
cccaactactttgcttattatccttctaacagtagcattgctggatttcttggggaaatg
ctcagtgcagctttcaatgtgatcggttttagttgggtaacttctccagctgctacagaa
cttgagatgatagttcttgattggcttgccaaattattgaagctgcccgatgactttctc
tcgtcaggaaacggcgggggagtaatacagggaactgccagtgaagctgttttagttgtg
ctactggctgctcgtgatcgagctctaagaagatttggaaaagattaccttaagaaacta
gttgtttatgcatctgatcaaacgcactctgctttacaaaaggcatgccagattggaggg
attcatcctgagaattgcagatggttgaaagcagatatttctaccaattatgccctttct
cccgatgttctttccgaagaactttcacgtgatacagccagaggattaattccatttttc
ttatgtgctacagttggaactacatcatcaacagctgtagaccctctccctgaactagga
actattgctaagaggcacgaaatgtggtttcacgttgatgctgcttatgctggaagtgca
tgtgtatgtcctgaatatcgacagtacattgacggtgttgaagaagctgactcattcaat
atgaatcttcacaagtggttcttgacaaacttcgattgttcagcactgtggatcaaggac
cgacatgccttgatccggtctctttctacgaatcctgagttcttgaagaacaaagcctct
gaagcagaactggttgtggattacaaagattggcaaattccacttgggcgccgttttaga
tcattgaaagtctggatggtgttacgactgtatggtacagaaaaccttcaaaaatacatt
agaaatcatatcagtttggctgaacgttttgaagcacttgtacgtgaagatccaaggttt
gagattgttacaccaaggattttctctctagtatgttttcgccttctgccatctcgcaaa
aatgaagatggtggcaacagactaaatcaaagcctattagatgctgtaaatgctagcgga
aatattttcatttctcacacggttttatcaggaaaatacattcttcgatttgcagtaggg
gcgccgttgacagaggaaaagcatattaattctgcttggaagttattgcaagatgtggct
tccactttgcttgcaatttga

DBGET integrated database retrieval system